DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33673 and FAIM2

DIOPT Version :9

Sequence 1:NP_001027218.2 Gene:CG33673 / 3772423 FlyBaseID:FBgn0053673 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_036438.2 Gene:FAIM2 / 23017 HGNCID:17067 Length:316 Species:Homo sapiens


Alignment Length:228 Identity:61/228 - (26%)
Similarity:110/228 - (48%) Gaps:20/228 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FEDRYSRRIFISRVLMIVAINLLVTTLIMTFCVFHMGARKFLLKH--WYIGLVGMGIILIFSFMI 78
            ::|:..||:|:.:|..|:.|.||||..::....|....:.::..:  ||  .....:.......:
Human    93 WDDQKVRRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWY--WASYAVFFATYLTL 155

  Fly    79 CCCSFLFRSSPCKYILLVIYVLAHSTVVCSAAVRYQPKLVFIAVASCAAIVVMLCL----FARFA 139
            .|||...|..|...|||.::.|:.:.:....:..|....|.:    |..|..::||    |:...
Human   156 ACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLL----CLGITALVCLSVTVFSFQT 216

  Fly   140 PCDFTGCWIFVFVLSLVVLIMG-IVAI-----FFPTIRIVYASLGVLLFCVYIVIDVQMIIGGGT 198
            ..|||.|...:|||.:.:...| |:||     :.|.:..|||:||..:|.:::.:|.|:::|...
Human   217 KFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLMGNRR 281

  Fly   199 HKNEFDESDYVLAAMSLYSDIVFLFLYLLDLIG 231
            |  .....:|:..|:::|.||:::|.:.|.|.|
Human   282 H--SLSPEEYIFGALNIYLDIIYIFTFFLQLFG 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33673NP_001027218.2 LFG_like 16..231 CDD:198410 60/226 (27%)
FAIM2NP_036438.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53
LFG_like 92..312 CDD:198410 60/226 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.