DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33673 and grina

DIOPT Version :9

Sequence 1:NP_001027218.2 Gene:CG33673 / 3772423 FlyBaseID:FBgn0053673 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001120085.1 Gene:grina / 100145094 XenbaseID:XB-GENE-5740104 Length:286 Species:Xenopus tropicalis


Alignment Length:226 Identity:66/226 - (29%)
Similarity:114/226 - (50%) Gaps:17/226 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FEDRYSRRIFISRVLMIVAINLLVTTLIMTFCVFHMGARKFLLKHW-----YIGLVGMGIILIFS 75
            |.:...||.||.:|.:.:|:.|.:|  :...|:|....|   ||:|     ||.......|:|.:
 Frog    65 FSESAIRRAFIRKVYLTLAMQLALT--VGLICMFIFWKR---LKNWVQEYPYIVYALCPAIIILA 124

  Fly    76 FMICCCSFLFRSSPCKYILLVIYVLAHSTVVCSAAVRYQPKLVFIAVASCAAIVVMLCLFARFAP 140
            .::.||..:.|..|..:|.|.::......::.:.|..:....|..|..:...:.:.|.:||....
 Frog   125 LVLACCQQVRRKVPYNFIFLGLFTAVEGCMLGTIAALFDADAVMWAGGATIVVTLGLTIFALQTK 189

  Fly   141 CDFT----GCWIFVFVLSLVVLIMGIVAIFFPTIRIVYASLGVLLFCVYIVIDVQMIIGGGTHKN 201
            .|||    |..:.:.||....::.||:...:  :.|||||:|..:|.:|:|:|.|:|: ||.|:.
 Frog   190 WDFTMLSGGLCVALLVLLCFGILCGILRSMY--LNIVYASIGTFIFGMYLVVDTQLIV-GGKHRY 251

  Fly   202 EFDESDYVLAAMSLYSDIVFLFLYLLDLIGL 232
            .....:|:.||:::|.||:.|||.||.:.|:
 Frog   252 AVSPEEYIFAALNIYLDIINLFLMLLQIFGI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33673NP_001027218.2 LFG_like 16..231 CDD:198410 65/223 (29%)
grinaNP_001120085.1 DUF4526 <4..>55 CDD:291688
LFG_like 64..281 CDD:198410 65/223 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.