DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33673 and faim2b

DIOPT Version :9

Sequence 1:NP_001027218.2 Gene:CG33673 / 3772423 FlyBaseID:FBgn0053673 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001373641.1 Gene:faim2b / 100006044 ZFINID:ZDB-GENE-120426-3 Length:263 Species:Danio rerio


Alignment Length:222 Identity:63/222 - (28%)
Similarity:112/222 - (50%) Gaps:8/222 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FEDRYSRRIFISRVLMIVAINLLVTTLIMTFCVFHMGARKFLLKHWYIGLVGMGIILIFSFMICC 80
            ::|...|||||.:|..|:.:.|..|..::....||...|.::..|..:......:.||....:.|
Zfish    40 WDDASVRRIFIRKVYSILMLQLFSTVAVIALFTFHAPVRMYIQTHPILYSASNLLFLITYISLAC 104

  Fly    81 CSFLFRSSPCKYILLVIYVLAHSTVVCSAAVRYQPKLVFIAVASCAAIVVMLCLFARFAPCDFTG 145
            |..|.|..|...|||.::.|:.:.::...:..|..|.|.:.:...|.:.:.:.||:..:..|.|.
Zfish   105 CGDLRRQFPWNLILLTVFTLSMACMLGFISSFYNTKAVVLCIGITAVVCLCVTLFSFQSKIDITS 169

  Fly   146 CWIFVFVLSLVV----LIMGIVAIF--FPTIRIVYASLGVLLFCVYIVIDVQMIIGGGTHKNEFD 204
            ....:|:|.:|:    ::||.|..|  .|.:..||:|:|.::|.:::..|.|:::|...:  ...
Zfish   170 YQGLLFILCMVMFFCAIVMGFVVPFGYVPWLHAVYSSIGAVVFTMFLAFDTQLLMGNKQY--TLS 232

  Fly   205 ESDYVLAAMSLYSDIVFLFLYLLDLIG 231
            ..:||.|.:|||.|||:||.:||.:.|
Zfish   233 PEEYVFATLSLYLDIVYLFTFLLQMFG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33673NP_001027218.2 LFG_like 16..231 CDD:198410 62/220 (28%)
faim2bNP_001373641.1 LFG_like 39..259 CDD:198410 62/220 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.