DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33845 and LOC102549173

DIOPT Version :9

Sequence 1:NP_001027353.1 Gene:His3:CG33845 / 3772421 FlyBaseID:FBgn0053845 Length:136 Species:Drosophila melanogaster
Sequence 2:XP_006254041.3 Gene:LOC102549173 / 102549173 RGDID:7709329 Length:253 Species:Rattus norvegicus


Alignment Length:113 Identity:112/113 - (99%)
Similarity:113/113 - (100%) Gaps:0/113 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat    39 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 103

  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113
            ||||||||||||||||||||||||||||||||||||||||||||||:|
  Rat   104 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCSI 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33845NP_001027353.1 PTZ00018 1..136 CDD:185400 112/113 (99%)
LOC102549173XP_006254041.3 PTZ00018 39..151 CDD:185400 111/111 (100%)
PLN00035 160..253 CDD:177669
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100119
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.