DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33845 and LOC100486720

DIOPT Version :9

Sequence 1:NP_001027353.1 Gene:His3:CG33845 / 3772421 FlyBaseID:FBgn0053845 Length:136 Species:Drosophila melanogaster
Sequence 2:XP_002944964.1 Gene:LOC100486720 / 100486720 -ID:- Length:136 Species:Xenopus tropicalis


Alignment Length:136 Identity:136/136 - (100%)
Similarity:136/136 - (100%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65

  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130

  Fly   131 IRGERA 136
            ||||||
 Frog   131 IRGERA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33845NP_001027353.1 PTZ00018 1..136 CDD:185400 134/134 (100%)
LOC100486720XP_002944964.1 PTZ00018 1..136 CDD:185400 134/134 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 257 1.000 Domainoid score I1981
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 265 1.000 Inparanoid score I2985
OMA 1 1.010 - - QHG54047
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000188
OrthoInspector 1 1.000 - - oto104803
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R543
SonicParanoid 1 1.000 - - X183
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.