DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BORCS7 and borcs7

DIOPT Version :9

Sequence 1:NP_725975.2 Gene:BORCS7 / 3772419 FlyBaseID:FBgn0034519 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_001035077.1 Gene:borcs7 / 664759 ZFINID:ZDB-GENE-050913-112 Length:103 Species:Danio rerio


Alignment Length:97 Identity:31/97 - (31%)
Similarity:58/97 - (59%) Gaps:3/97 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSSARHLFDESKKRLCV-RVGENANNLGSVARQVVRGSKSNEIMHQTLKNFT-QVDVVSDYSHQN 68
            ||..:..|.:|.|.|.. :|...:.::.::.|||::||:|.|::.|..:|.. |.|.:. :|..:
Zfish     3 SSETQPRFGQSVKGLLSDKVTSCSGDVIALTRQVLKGSRSQELLSQAARNMVIQEDAIL-HSEDS 66

  Fly    69 LQKMTLILQHVGYQYDVMQDSVNHLDYLKEQV 100
            |:||::|..|:.||.:.:|.:|.|...|::|:
Zfish    67 LRKMSIITTHLQYQQEAIQKNVEHSKNLQDQL 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BORCS7NP_725975.2 UPF0693 1..103 CDD:292706 31/97 (32%)
borcs7NP_001035077.1 BORCS7 3..101 CDD:374355 31/97 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579337
Domainoid 1 1.000 52 1.000 Domainoid score I11519
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5455
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007289
OrthoInspector 1 1.000 - - oto39112
orthoMCL 1 0.900 - - OOG6_109667
Panther 1 1.100 - - LDO PTHR31397
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4910
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.