DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BORCS7 and Borcs7

DIOPT Version :10

Sequence 1:NP_725975.2 Gene:BORCS7 / 3772419 FlyBaseID:FBgn0034519 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_079839.1 Gene:Borcs7 / 66439 MGIID:1913689 Length:105 Species:Mus musculus


Alignment Length:107 Identity:35/107 - (32%)
Similarity:61/107 - (57%) Gaps:12/107 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASAT-SSSARHLFDESKKRLCVRVGENANNLG----SVARQVVRGSKSNEIMHQTLKNFT-QVD 59
            ||:.| .|.||  |.:|.|.|   :.|..|..|    ::.:||::||:|:|::.|..:|.. |.|
Mouse     1 MATGTPDSQAR--FGQSVKGL---LTEKVNTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQED 60

  Fly    60 VVSDYSHQNLQKMTLILQHVGYQYDVMQDSVNHLDYLKEQVT 101
            .:. :|..:|:||.:|..|:.||.:.:|.:|.....|::|::
Mouse    61 AIL-HSEDSLRKMAIITTHLQYQQEAIQKNVEQSPDLQDQLS 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BORCS7NP_725975.2 BORCS7 1..103 CDD:465012 35/107 (33%)
Borcs7NP_079839.1 BORCS7 1..103 CDD:465012 35/107 (33%)

Return to query results.
Submit another query.