DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BORCS7 and Borcs7

DIOPT Version :9

Sequence 1:NP_725975.2 Gene:BORCS7 / 3772419 FlyBaseID:FBgn0034519 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_079839.1 Gene:Borcs7 / 66439 MGIID:1913689 Length:105 Species:Mus musculus


Alignment Length:107 Identity:35/107 - (32%)
Similarity:61/107 - (57%) Gaps:12/107 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASAT-SSSARHLFDESKKRLCVRVGENANNLG----SVARQVVRGSKSNEIMHQTLKNFT-QVD 59
            ||:.| .|.||  |.:|.|.|   :.|..|..|    ::.:||::||:|:|::.|..:|.. |.|
Mouse     1 MATGTPDSQAR--FGQSVKGL---LTEKVNTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQED 60

  Fly    60 VVSDYSHQNLQKMTLILQHVGYQYDVMQDSVNHLDYLKEQVT 101
            .:. :|..:|:||.:|..|:.||.:.:|.:|.....|::|::
Mouse    61 AIL-HSEDSLRKMAIITTHLQYQQEAIQKNVEQSPDLQDQLS 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BORCS7NP_725975.2 UPF0693 1..103 CDD:292706 35/107 (33%)
Borcs7NP_079839.1 BORCS7 1..103 CDD:406483 35/107 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835935
Domainoid 1 1.000 48 1.000 Domainoid score I11901
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I5468
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007289
OrthoInspector 1 1.000 - - oto94864
orthoMCL 1 0.900 - - OOG6_109667
Panther 1 1.100 - - LDO PTHR31397
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4910
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.880

Return to query results.
Submit another query.