DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BORCS7 and borcs7

DIOPT Version :10

Sequence 1:NP_725975.2 Gene:BORCS7 / 3772419 FlyBaseID:FBgn0034519 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_001016829.1 Gene:borcs7 / 549583 XenbaseID:XB-GENE-1006807 Length:112 Species:Xenopus tropicalis


Alignment Length:104 Identity:29/104 - (27%)
Similarity:56/104 - (53%) Gaps:9/104 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASATSSSARHLFDESKKRLCVRVGENANNLG----SVARQVVRGSKSNEIMHQTLKNFTQVDVV 61
            |.::|...||  :.:|.|.|   :.|..:..|    ::.:||::||.|:|::.|..:|....:..
 Frog     9 MTASTEGQAR--YGQSVKGL---LTEKVSTCGADVIALTKQVLKGSHSSELLGQAARNMVMQEDS 68

  Fly    62 SDYSHQNLQKMTLILQHVGYQYDVMQDSVNHLDYLKEQV 100
            ..:|..:|:||.:|..|:.||.:.:|.:|.....|::|:
 Frog    69 ILHSEDSLRKMAIITTHLQYQQEAIQKNVEQSSNLQDQL 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BORCS7NP_725975.2 BORCS7 1..103 CDD:465012 29/104 (28%)
borcs7NP_001016829.1 BORCS7 10..110 CDD:465012 28/103 (27%)

Return to query results.
Submit another query.