DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BORCS7 and borcs7

DIOPT Version :9

Sequence 1:NP_725975.2 Gene:BORCS7 / 3772419 FlyBaseID:FBgn0034519 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_001016829.1 Gene:borcs7 / 549583 XenbaseID:XB-GENE-1006807 Length:112 Species:Xenopus tropicalis


Alignment Length:104 Identity:29/104 - (27%)
Similarity:56/104 - (53%) Gaps:9/104 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASATSSSARHLFDESKKRLCVRVGENANNLG----SVARQVVRGSKSNEIMHQTLKNFTQVDVV 61
            |.::|...||  :.:|.|.|   :.|..:..|    ::.:||::||.|:|::.|..:|....:..
 Frog     9 MTASTEGQAR--YGQSVKGL---LTEKVSTCGADVIALTKQVLKGSHSSELLGQAARNMVMQEDS 68

  Fly    62 SDYSHQNLQKMTLILQHVGYQYDVMQDSVNHLDYLKEQV 100
            ..:|..:|:||.:|..|:.||.:.:|.:|.....|::|:
 Frog    69 ILHSEDSLRKMAIITTHLQYQQEAIQKNVEQSSNLQDQL 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BORCS7NP_725975.2 UPF0693 1..103 CDD:292706 29/104 (28%)
borcs7NP_001016829.1 BORCS7 10..110 CDD:406483 28/103 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I5291
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007289
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31397
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4910
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.090

Return to query results.
Submit another query.