DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BORCS7 and Borcs7

DIOPT Version :9

Sequence 1:NP_725975.2 Gene:BORCS7 / 3772419 FlyBaseID:FBgn0034519 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_001127981.1 Gene:Borcs7 / 294012 RGDID:1311783 Length:106 Species:Rattus norvegicus


Alignment Length:107 Identity:36/107 - (33%)
Similarity:61/107 - (57%) Gaps:12/107 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASAT-SSSARHLFDESKKRLCVRVGENANNLG----SVARQVVRGSKSNEIMHQTLKNFT-QVD 59
            |||.| .|.||  |.:|.|.|   :.|..|..|    ::.:||::||:|:|::.|..:|.. |.|
  Rat     2 MASGTPDSQAR--FGQSVKGL---LTEKVNTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQED 61

  Fly    60 VVSDYSHQNLQKMTLILQHVGYQYDVMQDSVNHLDYLKEQVT 101
            .:. :|..:|:||.:|..|:.||.:.:|.:|.....|::|::
  Rat    62 AIL-HSEDSLRKMAIITTHLQYQQEAIQKNVEQSPDLQDQLS 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BORCS7NP_725975.2 UPF0693 1..103 CDD:292706 36/107 (34%)
Borcs7NP_001127981.1 BORCS7 1..104 CDD:406483 36/107 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339573
Domainoid 1 1.000 51 1.000 Domainoid score I11338
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5374
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007289
OrthoInspector 1 1.000 - - oto98367
orthoMCL 1 0.900 - - OOG6_109667
Panther 1 1.100 - - LDO PTHR31397
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.850

Return to query results.
Submit another query.