DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BORCS7 and BORCS7

DIOPT Version :9

Sequence 1:NP_725975.2 Gene:BORCS7 / 3772419 FlyBaseID:FBgn0034519 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_001129672.1 Gene:BORCS7 / 119032 HGNCID:23516 Length:106 Species:Homo sapiens


Alignment Length:101 Identity:29/101 - (28%)
Similarity:55/101 - (54%) Gaps:2/101 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASATSSSARHLFDESKKRLCVRVGENANNLGSVARQVVRGSKSNEIMHQTLKNFT-QVDVVSDY 64
            ||:.|..|........|..|..:|.....::.::.:||::||:|:|::.|..:|.. |.|.:. :
Human     2 MATGTPESQARFGQSVKGLLTEKVTTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQEDAIL-H 65

  Fly    65 SHQNLQKMTLILQHVGYQYDVMQDSVNHLDYLKEQV 100
            |..:|:||.:|..|:.||.:.:|.:|.....|::|:
Human    66 SEDSLRKMAIITTHLQYQQEAIQKNVEQSSDLQDQL 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BORCS7NP_725975.2 UPF0693 1..103 CDD:292706 29/101 (29%)
BORCS7NP_001129672.1 BORCS7 1..104 CDD:339603 29/101 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145861
Domainoid 1 1.000 49 1.000 Domainoid score I11867
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5485
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007289
OrthoInspector 1 1.000 - - oto91285
orthoMCL 1 0.900 - - OOG6_109667
Panther 1 1.100 - - LDO PTHR31397
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4910
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.