DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4970 and CCDC96

DIOPT Version :9

Sequence 1:NP_001027253.1 Gene:CG4970 / 3772412 FlyBaseID:FBgn0032364 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_699207.1 Gene:CCDC96 / 257236 HGNCID:26900 Length:555 Species:Homo sapiens


Alignment Length:564 Identity:103/564 - (18%)
Similarity:197/564 - (34%) Gaps:198/564 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 PDWDELSDIGTTDHNLGIDKKSVEMQQVPGSELEQLQIQLARKSLSSSME------------SLI 258
            |:.:|.:::|..:          ..|..||:..|:|:.:...:.|..:.|            :.|
Human    95 PEPEEPAEVGAEE----------PAQPEPGAGPEELEAEAGAEELEQAAEGKEVRFQASLPLTRI 149

  Fly   259 PSESNYEAPSSQ------NDDDVHGTE-------------IPSPS--------GLESVDESDW-- 294
            ..|....||.::      .::|...|:             .|:.|        |.:..::.:|  
Human   150 DEEEAAAAPEAETERVEGEEEDKEETQRDGAESKERDGEGRPAKSQEEGKRLYGRDEFEDLEWSE 214

  Fly   295 ---RLQGMQFKSSHVATFKDITSESRSSTSSLNSIPTTFSIGQMVQSYLDGLIEKVVDIFVNTDY 356
               :||..|.:|..:..::.:..|...|              |....||...|.:.:        
Human   215 EVQKLQEQQLRSDLLDQYRSLLVERNRS--------------QRYNLYLQHKIFEAL-------- 257

  Fly   357 LRSKNLDKSKLMNRLFKEVEDHHWVSHDNNLLTKRLTEHHLRRFKYSLVTPSSRSYINESQRSRY 421
            .|.|.|:.:::.:| ..|.|                            .....::|:      |:
Human   258 RRKKGLEAAEVADR-GAEAE----------------------------APEKEQAYL------RH 287

  Fly   422 LGALNELDHWLNRTRQAEQMHLAEKERLLSELERMQREDNEKIERLEEIFR------STLLRDSQ 480
            ||.|.||     :.:||:.:....:     ||.:::|:..||:.|:|:.:|      ..::..:.
Human   288 LGMLEEL-----KKQQADDLQWYHQ-----ELGQLKRQCQEKLTRVEKEWRRFQALKKQVVMQAM 342

  Fly   481 PSERLRFVTETALKQMR-------AKRDALSATRLILIIRQHDNSYIKKKVDEIEAISGEVKLET 538
            .|.|:|...:.||:::.       .|...:||.||       :|..:|:.:         |..||
Human   343 GSCRMRGGRQAALREVEQIQALEDKKEKEMSAVRL-------ENIQLKQSL---------VHFET 391

  Fly   539 YLSADNDVQQMV------------TTLNNK----NAELERMCTLVKTKIHTISHLRCRRKLLNRK 587
            .:....|:.|.:            .|.|.|    |.||.::.:.|...:..|:|::.:...::.:
Human   392 RMRTQEDLTQGLLLIDFEQLKIENQTFNEKIEERNEELLKLRSKVTNSVQVITHVKEKLHFMDME 456

  Fly   588 FREAKDELRERQKRQIALRDEVYNCNLTHNKLLDQIKEVRREG------------GIMCYPKLLA 640
            ....|.:|.|.:.:....||           :|.:.|:. |||            |::....||.
Human   457 NACKKTQLAEIEAQAALGRD-----------ILTKTKQA-REGLRTDNIRLNQKCGLLGKDSLLR 509

  Fly   641 DF----DRTEKFIAIKQASIVELKTQHDNLLKRIEKIELKILES 680
            |.    |:||    :....:..||..|.:|......:..||.|:
Human   510 DLEEKVDKTE----LLHRRLESLKRHHASLTLSCRGVRQKIREA 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4970NP_001027253.1 DUF4201 496..670 CDD:290581 42/212 (20%)
CCDC96NP_699207.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..202 18/116 (16%)
DUF4201 365..541 CDD:290581 42/207 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.