DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33864 and Hp1bp3

DIOPT Version :9

Sequence 1:NP_001027384.1 Gene:His1:CG33864 / 3772409 FlyBaseID:FBgn0053864 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_038965988.1 Gene:Hp1bp3 / 313647 RGDID:735099 Length:578 Species:Rattus norvegicus


Alignment Length:330 Identity:82/330 - (24%)
Similarity:120/330 - (36%) Gaps:109/330 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VVQKKASGSAGTKAKKASATPSHPPT--QQMVDASIKNLKERGGSSLLAIKKYITATYKCDAQKL 86
            ||||..:.......||.||....|..  :.::..:...|.|...:|...|:||::..|......:
  Rat   255 VVQKSKTPQKSKNRKKGSAVDPEPQVKLEDVLPLAFTRLCEPKEASYSLIRKYVSQYYPKLRVDI 319

  Fly    87 AP-FIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKE------------------KDPKA--- 129
            .| .:|..|:.||..|:|.|..||||||:|:|..|.:|.                  .:||.   
  Rat   320 RPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPLLGGSLMEYAILSAIAAMNEPKTCST 384

  Fly   130 -----------------------KSKVLSAEKKVQSKKVASKKIGVSS----------------- 154
                                   |..:...||....::::.|  |.|.                 
  Rat   385 TALKKYVLENHPGTNSNYQMHLLKKTLQKCEKNGWLEQISGK--GFSGTFQLCFPYYPSPGVLFP 447

  Fly   155 KKTAVG----------------AADKKPKAKKAVATKKTAENK-KTEKAKAKDAKKTGIIKSKPA 202
            ||.:.|                :.|::|..|:::..|..|:.: ||...|.:.||..   :..||
  Rat   448 KKVSDGSEDEDEEEDEEESSEDSEDEEPPPKRSLQKKTPAKPQGKTASMKQRGAKPA---RKVPA 509

  Fly   203 ATKAKV----TAAKPKAVVAKASKAKPAVSAKPKKTVKKASVSATAKKP------------KAKT 251
            |.:.||    ..|.||| ...|.|.:||.||     |||.| .:|:|||            |.|:
  Rat   510 AQRGKVRPLPKKAPPKA-KTPARKGRPAPSA-----VKKPS-GSTSKKPVANARKEAKLPGKGKS 567

  Fly   252 TAAKK 256
            ...||
  Rat   568 AMKKK 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33864NP_001027384.1 Linker_histone 46..118 CDD:278939 23/74 (31%)
Hp1bp3XP_038965988.1 H15 180..264 CDD:238028 4/8 (50%)
H15 276..342 CDD:197772 16/65 (25%)
Linker_histone 369..434 CDD:395429 8/66 (12%)
valS <479..555 CDD:237855 30/85 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.