DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33864 and H1-3

DIOPT Version :9

Sequence 1:NP_001027384.1 Gene:His1:CG33864 / 3772409 FlyBaseID:FBgn0053864 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_005311.1 Gene:H1-3 / 3007 HGNCID:4717 Length:221 Species:Homo sapiens


Alignment Length:271 Identity:101/271 - (37%)
Similarity:125/271 - (46%) Gaps:66/271 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAP-PATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERG 64
            ||::|      |:|.. ||..||..|:|||..:..|..|:.:   |.||..:::..::...|||.
Human     1 MSETA------PLAPTIPAPAEKTPVKKKAKKAGATAGKRKA---SGPPVSELITKAVAASKERS 56

  Fly    65 GSSLLAIKKYITAT-YKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLS-ASAKKEKDP 127
            |.||.|:||.:.|. |  |.:|....||..|||.|..|.|:||||.||||||||: .:|..|..|
Human    57 GVSLAALKKALAAAGY--DVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEGKP 119

  Fly   128 KAKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAK----- 187
            ||                  ||.|.:..:...||| ||||.....||.|.:..|..:|.|     
Human   120 KA------------------KKAGAAKPRKPAGAA-KKPKKVAGAATPKKSIKKTPKKVKKPATA 165

  Fly   188 ------AKDAKKTGIIKSKPAA-TKAKVTAAKPKAVVAKASKAKPAVSAKPKKTVKKASVSATAK 245
                  ||.|||....:.|.|| :.||..|.||||       |||. |.|||.|           
Human   166 AGTKKVAKSAKKVKTPQPKKAAKSPAKAKAPKPKA-------AKPK-SGKPKVT----------- 211

  Fly   246 KPKAKTTAAKK 256
              |||..|.||
Human   212 --KAKKAAPKK 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33864NP_001027384.1 Linker_histone 46..118 CDD:278939 34/72 (47%)
H1-3NP_005311.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 18/50 (36%)
Linker_histone 39..109 CDD:278939 34/71 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..221 64/171 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10654
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4734
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.