DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bw and malK

DIOPT Version :9

Sequence 1:NP_001286769.1 Gene:bw / 37724 FlyBaseID:FBgn0000241 Length:675 Species:Drosophila melanogaster
Sequence 2:NP_418459.1 Gene:malK / 948537 ECOCYCID:EG10558 Length:371 Species:Escherichia coli


Alignment Length:307 Identity:61/307 - (19%)
Similarity:111/307 - (36%) Gaps:99/307 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ELRILQDASGHMKTGDLIAILGGSGAGKTTLLAAISQRLRGNLTGDVVLNGMAMERHQMTRISSF 109
            |:.:.:|.:..:..|:.:..:|.||.||:|||..|: .|....:||:.:....|         :.
E. coli    15 EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIA-GLETITSGDLFIGEKRM---------ND 69

  Fly   110 LPQFEINV----KTFTAYEHLYFMSHFKMHRRTTKAEK---RQRVADLLLAVGLRDAAHTRIQQL 167
            .|..|..|    :::..|.||....:.....:...|:|   .|||..:...:.|......:.:.|
E. coli    70 TPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKAL 134

  Fly   168 SGGERKRLSLAEELITDPIFLFCDEPTTGLDSFSAYSVIKTLRHLCTRRRIAKHSLNQVYGEDSF 232
            |||:|:|:::...|:.:|.....|||.:.||:        .||                      
E. coli   135 SGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDA--------ALR---------------------- 169

  Fly   233 ETPSGESSASGSGSKSIEMEV-VAESHESLLQTMRELPALGVLSNSPNGTHKKAAICSIHQPTSD 296
                            ::|.: ::..|:.|.:||..:            ||.:.          :
E. coli   170 ----------------VQMRIEISRLHKRLGRTMIYV------------THDQV----------E 196

  Fly   297 IFELFTHIILMDGGRIVYQGRTEQAAKFFTDLGYELPLNCNPADFYL 343
            ...|...|:::|.||:             ..:|..|.|...|||.::
E. coli   197 AMTLADKIVVLDAGRV-------------AQVGKPLELYHYPADRFV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bwNP_001286769.1 P-loop_NTPase 31..316 CDD:304359 55/278 (20%)
3a01204 40..673 CDD:273361 61/307 (20%)
ABC2_membrane 404..604 CDD:279410
malKNP_418459.1 PRK11000 1..371 CDD:182893 61/307 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm14987
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.