DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bw and ugpC

DIOPT Version :9

Sequence 1:NP_001286769.1 Gene:bw / 37724 FlyBaseID:FBgn0000241 Length:675 Species:Drosophila melanogaster
Sequence 2:NP_417907.2 Gene:ugpC / 947953 ECOCYCID:EG11048 Length:356 Species:Escherichia coli


Alignment Length:336 Identity:79/336 - (23%)
Similarity:135/336 - (40%) Gaps:69/336 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GDLIAILGGSGAGKTTLLAAISQRLRGNLTGDVVLNGMAMERHQMTRISSFLPQ---FEINVKTF 120
            |:.|.::|.||.||:|||..:: .|.....||:.:|..        |::...|:   ..:..:.:
E. coli    30 GEFIVMVGPSGCGKSTLLRMVA-GLERVTEGDIWINDQ--------RVTEMEPKDRGIAMVFQNY 85

  Fly   121 TAYEHLYF---MSHFKMHRRTTKAEKRQRVADLLLAVGLRDAAHTRIQQLSGGERKRLSLAEELI 182
            ..|.|:..   |:.....|...|.:..:||.:....:.|......|.::||||:|:|:::...::
E. coli    86 ALYPHMSVEENMAWGLKIRGMGKQQIAERVKEAARILELDGLLKRRPRELSGGQRQRVAMGRAIV 150

  Fly   183 TDP-IFLFCDEPTTGLDSFSAYSVIKTLRHLCTRRRIAKHSLNQVYGE-DSFETPSGESSASGSG 245
            .|| :||| |||.:.||:.....:...|:.|  .||:...||...:.: ::..........:|..
E. coli   151 RDPAVFLF-DEPLSNLDAKLRVQMRLELQQL--HRRLKTTSLYVTHDQVEAMTLAQRVMVMNGGV 212

  Fly   246 SKSI--EMEVVAESHESLLQTMRELPALGVLSNSPN--GTHKKAAICSIHQPTSDIFELFTHIIL 306
            ::.|  .:||..:.....:.:....||:.:|:...|  |||               |||...|.|
E. coli   213 AEQIGTPVEVYEKPASLFVASFIGSPAMNLLTGRVNNEGTH---------------FELDGGIEL 262

  Fly   307 -MDGGRIVYQGRTEQAAKFFTDLGYELPLNCNPADFYLKTLAD------KEGKENAGAVLRAKYE 364
             ::||...|.||             ::.|...|....|.:.|:      .:..|..||       
E. coli   263 PLNGGYRQYAGR-------------KMTLGIRPEHIALSSQAEGGVPMVMDTLEILGA------- 307

  Fly   365 HETDGLYSGSW 375
               |.|..|.|
E. coli   308 ---DNLAHGRW 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bwNP_001286769.1 P-loop_NTPase 31..316 CDD:304359 66/269 (25%)
3a01204 40..673 CDD:273361 79/336 (24%)
ABC2_membrane 404..604 CDD:279410
ugpCNP_417907.2 ugpC 1..356 CDD:236947 79/336 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm14987
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.