DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bw and afuC

DIOPT Version :9

Sequence 1:NP_001286769.1 Gene:bw / 37724 FlyBaseID:FBgn0000241 Length:675 Species:Drosophila melanogaster
Sequence 2:NP_414796.2 Gene:afuC / 947676 ECOCYCID:EG12340 Length:348 Species:Escherichia coli


Alignment Length:346 Identity:74/346 - (21%)
Similarity:126/346 - (36%) Gaps:126/346 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GDLIAILGGSGAGKTTLLAAISQRLRGNLTGDVVLNGMAMERHQMTRISSFLPQFEINV--KTFT 121
            |.::.:||.||.||||:|..:: .|.....|.:.::|     ..:|..|  :.|.:|.:  :::.
E. coli    32 GQMVTLLGPSGCGKTTILRLVA-GLEKPSEGQIFIDG-----EDVTHRS--IQQRDICMVFQSYA 88

  Fly   122 AYEHLYFMSH----FKMHRRTTKAEKRQRVADLLLAVGLRDAAHTRIQQLSGGERKRLSLAEELI 182
            .:.|:....:    .|| ....:||.:.||.:.|..|.|.......:.|:|||:::|::||..||
E. coli    89 LFPHMSLGENVGYGLKM-LGVPRAELKARVKEALAMVDLEGFEDRFVDQISGGQQQRVALARALI 152

  Fly   183 TDPIFLFCDEPTTGLDSFSAYSVIKTLRHLCTRRRIAKHSLNQVYGEDSFETPSGESSASGSGSK 247
            ..|..|..|||.:.||                                                 
E. coli   153 LKPKVLLFDEPLSNLD------------------------------------------------- 168

  Fly   248 SIEMEVVAESHESLLQTMRELPALGVLSNSPNGTHKKAAICSIH--QPTSDIFELFTHIILMDGG 310
                   |....|:...:|||             .|:..|.|::  ...|:.|.:...:::|:.|
E. coli   169 -------ANLRRSMRDKIREL-------------QKQFDITSLYVTHDQSEAFAVSDTVLVMNKG 213

  Fly   311 RIVYQGRTEQ-----AAKF--------------FTD-----LGYELPLNCNPADFYLK------- 344
            .|:..|..:.     |::|              |:|     .||.||   .|..|..:       
E. coli   214 HIMQIGSPQDLYRQPASRFMASFMGDANLFPATFSDGYVDIYGYHLP---RPLHFGTQGEGMVGV 275

  Fly   345 -----TLADKEGKENAGAVLR 360
                 ||:|: |:|:...|:|
E. coli   276 RPEAITLSDR-GEESQRCVIR 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bwNP_001286769.1 P-loop_NTPase 31..316 CDD:304359 56/264 (21%)
3a01204 40..673 CDD:273361 74/346 (21%)
ABC2_membrane 404..604 CDD:279410
afuCNP_414796.2 fbpC 1..348 CDD:183133 74/346 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm14984
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.