DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bw and fetA

DIOPT Version :9

Sequence 1:NP_001286769.1 Gene:bw / 37724 FlyBaseID:FBgn0000241 Length:675 Species:Drosophila melanogaster
Sequence 2:NP_415023.1 Gene:fetA / 946990 ECOCYCID:G6266 Length:225 Species:Escherichia coli


Alignment Length:205 Identity:51/205 - (24%)
Similarity:90/205 - (43%) Gaps:29/205 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ELRILQDASGHMKTGDLIAILGGSGAGKTTLLAAISQRLRGNLTGDVVLNGMAMERHQMTRISSF 109
            :.:||.:.:..::.|:...|.|.||.||:|||..::. |....:|.::..|        ..:|:.
E. coli    19 DAKILNNINFSLRAGEFKLITGPSGCGKSTLLKIVAS-LISPTSGTLLFEG--------EDVSTL 74

  Fly   110 LPQFEINVKTF----------TAYEHLYFMSHFKMHRRTTKAEKRQRVADLLLAVGLRDAAHTR- 163
            .|:......::          |.|::|.|....: :|:...|    ...|.|....|.|:..|: 
E. coli    75 KPEIYRQQVSYCAQTPTLFGDTVYDNLIFPWQIR-NRQPDPA----IFLDFLERFALPDSILTKN 134

  Fly   164 IQQLSGGERKRLSLAEELITDPIFLFCDEPTTGLDSFSAYSVIKTLRHLCTRRRIA----KHSLN 224
            |.:|||||::|:||...|...|..|..||.|:.||..:.::|.:.:......:.||    .|..:
E. coli   135 IAELSGGEKQRISLIRNLQFMPKVLLLDEITSALDESNKHNVNEMIHRYVREQNIAVLWVTHDKD 199

  Fly   225 QVYGEDSFET 234
            ::...|...|
E. coli   200 EINHADKVIT 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bwNP_001286769.1 P-loop_NTPase 31..316 CDD:304359 51/205 (25%)
3a01204 40..673 CDD:273361 51/205 (25%)
ABC2_membrane 404..604 CDD:279410
fetANP_415023.1 PRK10247 1..225 CDD:182331 51/205 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9743
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.