DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bw and cysA

DIOPT Version :9

Sequence 1:NP_001286769.1 Gene:bw / 37724 FlyBaseID:FBgn0000241 Length:675 Species:Drosophila melanogaster
Sequence 2:NP_416917.1 Gene:cysA / 946889 ECOCYCID:EG10183 Length:365 Species:Escherichia coli


Alignment Length:376 Identity:91/376 - (24%)
Similarity:145/376 - (38%) Gaps:80/376 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RILQDASGHMKTGDLIAILGGSGAGKTTLLAAISQRLRGNLTGDVVLNGMAMER-HQMTRISSFL 110
            ::|.|.|..:.:|.::|:||.||:||||||..|: .|....:|.:..:|..:.| |...|...|:
E. coli    16 QVLNDISLDIPSGQMVALLGPSGSGKTTLLRIIA-GLEHQTSGHIRFHGTDVSRLHARDRKVGFV 79

  Fly   111 PQFEINVKTFTAYEHLYF-MSHFKMHRRTTKAEKRQRVADLLLAVGLRDAAHTRIQQLSGGERKR 174
            .|.....:..|.::::.| ::......|...|..:.:|..||..|.|...|.....|||||:::|
E. coli    80 FQHYALFRHMTVFDNIAFGLTVLPRRERPNAAAIKAKVTKLLEMVQLAHLADRYPAQLSGGQKQR 144

  Fly   175 LSLAEELITDPIFLFCDEPTTGLDSFSAYSVIKTLRHLCTRRRIAKHSLNQVYGE----DSFETP 235
            ::||..|..:|..|..|||...||:    .|.|.||..          |.|::.|    ..|.|.
E. coli   145 VALARALAVEPQILLLDEPFGALDA----QVRKELRRW----------LRQLHEELKFTSVFVTH 195

  Fly   236 SGESSASGSGSKSIEMEVVAESHESLLQTMRELPALGVLSNSPNGTHKKAAICSIHQPTSDIFEL 300
            ..|.:.      .:...||..|..::.|           :::|:...::.|       |..:.|.
E. coli   196 DQEEAT------EVADRVVVMSQGNIEQ-----------ADAPDQVWREPA-------TRFVLEF 236

  Fly   301 FTHIILMD----GGRI-------------VYQGRTEQAAKFF-------TDLGYELP---LNCNP 338
            ...:..:.    ||:.             .|||..:...:.:       |.|...||   |..:|
E. coli   237 MGEVNRLQGTIRGGQFHVGAHRWPLGYTPAYQGPVDLFLRPWEVDISRRTSLDSPLPVQVLEASP 301

  Fly   339 ADFYLKTLADKEGKENAGAVLRAKYEHETDGLYSGSWLL-----ARSYSGD 384
            ...|.:.:....|..|....:   ..|..|....|..|.     ||.|:||
E. coli   302 KGHYTQLVVQPLGWYNEPLTV---VMHGDDAPQRGERLFVGLQHARLYNGD 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bwNP_001286769.1 P-loop_NTPase 31..316 CDD:304359 71/291 (24%)
3a01204 40..673 CDD:273361 91/376 (24%)
ABC2_membrane 404..604 CDD:279410
cysANP_416917.1 PRK10851 1..352 CDD:182778 91/376 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm14984
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.