DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bw and lolD

DIOPT Version :10

Sequence 1:NP_523824.1 Gene:bw / 37724 FlyBaseID:FBgn0000241 Length:675 Species:Drosophila melanogaster
Sequence 2:NP_415635.4 Gene:lolD / 945670 ECOCYCID:G6574 Length:233 Species:Escherichia coli


Alignment Length:195 Identity:64/195 - (32%)
Similarity:102/195 - (52%) Gaps:33/195 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NECRKKRE----LRILQDASGHMKTGDLIAILGGSGAGKTTLLAAISQRLRGNL----TGDVVLN 94
            |.|::.:|    ..:|.:.|..:..|:::||:|.||:||:|||     .|.|.|    :|||:.|
E. coli    10 NLCKRYQEGSVQTDVLHNVSFSVGEGEMMAIVGSSGSGKSTLL-----HLLGGLDTPTSGDVIFN 69

  Fly    95 GMAMERHQMTRISS------------FLPQFEINVKTFTAYEHLYFMSHFKMHRRTTKAEKRQRV 147
            |     ..|:::||            |:.||...:..|||.|::...   .:..:...||...|.
E. coli    70 G-----QPMSKLSSAAKAELRNQKLGFIYQFHHLLPDFTALENVAMP---LLIGKKKPAEINSRA 126

  Fly   148 ADLLLAVGLRDAAHTRIQQLSGGERKRLSLAEELITDPIFLFCDEPTTGLDSFSAYSVIKTLRHL 212
            .::|.||||...|:.|..:||||||:|:::|..|:.:|..:..||||..||:.:|.|:.:.|..|
E. coli   127 LEMLKAVGLDHRANHRPSELSGGERQRVAIARALVNNPRLVLADEPTGNLDARNADSIFQLLGEL 191

  Fly   213  212
            E. coli   192  191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bwNP_523824.1 3a01204 40..673 CDD:273361 63/193 (33%)
lolDNP_415635.4 lolD 1..233 CDD:183244 64/195 (33%)

Return to query results.
Submit another query.