DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bw and AgaP_AGAP009467

DIOPT Version :9

Sequence 1:NP_001286769.1 Gene:bw / 37724 FlyBaseID:FBgn0000241 Length:675 Species:Drosophila melanogaster
Sequence 2:XP_001688275.1 Gene:AgaP_AGAP009467 / 5668141 VectorBaseID:AGAP009467 Length:199 Species:Anopheles gambiae


Alignment Length:156 Identity:38/156 - (24%)
Similarity:67/156 - (42%) Gaps:15/156 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   452 GGSIFMLSNEMIFTFSYGVTYIFPAALPIIRREVGEGTYSLSAYYVALVLSFVPVAFFKGYVFLS 516
            |..:|.....:.|..:......||....:..||.....|||.|||::.:::.:|:......|||:
Mosquito     4 GACLFFFQLFIFFGNAMPCVITFPLETKVFVRERLNNWYSLEAYYLSKIVADLPLQLICPSVFLA 68

  Fly   517 VIYASIYYTRGFLL----YLSMGFLMSLSAVAAVGYGVFLSSLFESDKMASECAAPFDLIFLIFG 577
            :    .||..|..|    :..:..::.|..:.|...|:...:.|:. :||:.....|.:..|:|.
Mosquito    69 I----AYYLTGQPLEWERFGKLALVLLLLGIFAQTVGLLSGAAFDI-QMATFFVPCFSIPSLLFS 128

  Fly   578 GTY-----MNVDTVPGLKYLSLFFYS 598
            |.:     || :.:..:.|.|.|.||
Mosquito   129 GFFVKPYEMN-EYLGYVAYTSFFRYS 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bwNP_001286769.1 P-loop_NTPase 31..316 CDD:304359
3a01204 40..673 CDD:273361 38/156 (24%)
ABC2_membrane 404..604 CDD:279410 38/156 (24%)
AgaP_AGAP009467XP_001688275.1 ABC2_membrane <23..160 CDD:279410 35/137 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0061
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1022017at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.