DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bw and AgaP_AGAP009469

DIOPT Version :9

Sequence 1:NP_001286769.1 Gene:bw / 37724 FlyBaseID:FBgn0000241 Length:675 Species:Drosophila melanogaster
Sequence 2:XP_001688273.1 Gene:AgaP_AGAP009469 / 5668135 VectorBaseID:AGAP009469 Length:243 Species:Anopheles gambiae


Alignment Length:304 Identity:87/304 - (28%)
Similarity:134/304 - (44%) Gaps:79/304 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PSLCLEWKQLNYYVPDQEQSNYSFWNECRKKRELRILQDASGHMKTGDLIAILGGSGAGKTTLLA 77
            |...||::.:.|.|..::..|            .::|...||...:|.|..|||.|||||:|||.
Mosquito    18 PPTTLEFRDICYQVRHKDGQN------------KQLLNSVSGAFHSGRLAGILGPSGAGKSTLLN 70

  Fly    78 AISQRLRGNLTGDVVLNGMAMERHQMTRISSFLPQFEINVKTFTAYEHLYFMSHFKMHRRTTKAE 142
            .:|.....|::|::::||..::|.:..|..|:.||....:...|..|.|.|.:..|:...||.|:
Mosquito    71 ILSGFKTNNVSGNILINGTPIDRRKYRREVSYTPQDICLLGNITVTESLEFAADLKLSPTTTIAQ 135

  Fly   143 KRQRVADLLLAVGLRDAAHTRIQQLSGGERKRLSLAEELITDPIFLFCDEPTTGLDSFSAYSVIK 207
            |...|.|:|..:||...||..:..:||||:||||:..|||::|..:|.||||:|||..:|..|:.
Mosquito   136 KSAMVVDVLKLLGLSKCAHNPVANISGGEKKRLSIGLELISNPSIMFFDEPTSGLDIIAAMQVVA 200

  Fly   208 TLRHLCTRRRIAKHSLNQVYGEDSFETPSGESSASGSGSKSIEMEVVAESHESLLQTMRELPALG 272
            .|:.|                           :|||                             
Mosquito   201 HLKDL---------------------------AASG----------------------------- 209

  Fly   273 VLSNSPNGTHKKAAICSIHQPTSDIFELFTHIILMDGGRIVYQG 316
                       :..||.||||:|.|.::|..:.::..|..:|:|
Mosquito   210 -----------RCVICVIHQPSSSILQMFDDLFVLSEGHCLYRG 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bwNP_001286769.1 P-loop_NTPase 31..316 CDD:304359 81/284 (29%)
3a01204 40..673 CDD:273361 81/277 (29%)
ABC2_membrane 404..604 CDD:279410
AgaP_AGAP009469XP_001688273.1 ABCG_EPDR 22..242 CDD:213180 85/298 (29%)
LolD 22..237 CDD:224059 83/293 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0061
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.