DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bw and CG11069

DIOPT Version :9

Sequence 1:NP_001286769.1 Gene:bw / 37724 FlyBaseID:FBgn0000241 Length:675 Species:Drosophila melanogaster
Sequence 2:NP_651307.2 Gene:CG11069 / 42976 FlyBaseID:FBgn0039244 Length:604 Species:Drosophila melanogaster


Alignment Length:575 Identity:134/575 - (23%)
Similarity:224/575 - (38%) Gaps:163/575 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ILQDASGHMKTGDLIAILGGSGAGKTTLLAAISQRLRGNLTGDVVLNGMAMERHQMTRISSFLPQ 112
            :|:..:..:.:|:::||||..|:||..||..||:|..|...|.|:|||..:.:....:...::.|
  Fly    36 VLKGVNLTVHSGEVMAILGSKGSGKRALLDVISRRADGATRGQVLLNGSPLSKALFQQRCGYVTQ 100

  Fly   113 FEINVKTFTAYEHLYF----MSHFKMHRRTTKAEK-RQRVADLLLAVGLRDAAHTRIQQLSGGER 172
            ....|...|..:.|::    :|.:      .|:.| ||.:|||.|:    ..||.|::.|:..|.
  Fly   101 SCTFVPGLTVAQTLHYTPTILSGY------LKSSKVRQVLADLALS----QVAHKRVEYLNISEA 155

  Fly   173 KRLSLAEELITDPIFLFCDEPTTGLDSFSAYSVIKTLRHLCTRRRIAKHSLNQVYGEDSFETPSG 237
            :||::..:|:.||:.|..||||.|||..|||.:|                               
  Fly   156 RRLAIGIQLVRDPVMLLLDEPTHGLDPLSAYLLI------------------------------- 189

  Fly   238 ESSASGSGSKSIEMEVVAESHESLLQTMRELPALGVLSNSPNGTHKKAA---ICSIHQPTSDIFE 299
                                              .:|||    |.||..   :.|:.:|.||:|.
  Fly   190 ----------------------------------SILSN----TAKKTGCGILLSLEKPRSDVFP 216

  Fly   300 LFTHIILMDGGRIVYQGRTEQAAKFFTDLGYELPLNCNPADFYL-KTLADKEGK----ENAGAV- 358
            .....:.:..|.:||.|.|....::|..:|:..|...||..:|| .:..|:..:    |::..: 
  Fly   217 FLDRALFLCLGGVVYSGGTRAMLEYFHGIGFPCPQLENPLMYYLCLSTVDRRSRDRFLESSQQIE 281

  Fly   359 -LRAKYEHET-------DGLYSGSWLLARSYSGDYLKHVQNFKKIRWIYQVYLLMVRFMTEDLRN 415
             |..::..||       :.:.||...||....|:.        |: |: .:||.::      ...
  Fly   282 ALVERFSRETPISDAPLNNMGSGKVPLAYGKPGEL--------KV-WV-MLYLKLL------AST 330

  Fly   416 IRSGLIA----FGFFMITAVTLSLM---YSGIGGLTQRTVQDVGGSIFMLSNEMIFT---FSYGV 470
            ...||:.    |...::..:.||::   |:.:|       .|..|  |...|.||..   .|||.
  Fly   331 FSCGLVGMKTLFLRLLLLPLALSILWAFYTDVG-------DDSHG--FFTKNGMILNILGLSYGC 386

  Fly   471 TYIFPAAL-PIIRR----EVGEGTYSLSAYYVALVLSFVPVAFFKGYVFLSVIY---ASIYYTRG 527
            ..:...:| ||.|:    :..||.||.:...:|.....:|.:.....:...|:|   ..:.|..|
  Fly   387 GILTTISLFPIWRKKFSQDTPEGLYSGTTLLIAYNSVSIPFSAVSAVIASCVVYPLLLDVKYNNG 451

  Fly   528 -------------FLL--YLSMGFLM----SLSAVAAVGYGVFLSSLFESDKMAS 563
                         |:|  .|::.||:    ..:|..||.|.:.:|....|..:.|
  Fly   452 TVFAYLLVALWSSFVLAEQLTIAFLLVVKVPFNAAIAVTYVLVISIALASGTVRS 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bwNP_001286769.1 P-loop_NTPase 31..316 CDD:304359 69/275 (25%)
3a01204 40..673 CDD:273361 134/575 (23%)
ABC2_membrane 404..604 CDD:279410 42/197 (21%)
CG11069NP_651307.2 ABCG_White 15..233 CDD:213201 69/275 (25%)
CcmA 31..302 CDD:224054 83/344 (24%)
ABC2_membrane 364..515 CDD:304374 35/145 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0061
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1022017at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48041
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.