DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bw and AgaP_AGAP009470

DIOPT Version :9

Sequence 1:NP_001286769.1 Gene:bw / 37724 FlyBaseID:FBgn0000241 Length:675 Species:Drosophila melanogaster
Sequence 2:XP_559779.3 Gene:AgaP_AGAP009470 / 3291976 VectorBaseID:AGAP009470 Length:226 Species:Anopheles gambiae


Alignment Length:226 Identity:53/226 - (23%)
Similarity:88/226 - (38%) Gaps:37/226 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   457 MLSNE------MIFTF---SYGVTYIFPAALPIIRREVGEGTYSLSAYYVALVLSFVPVAFFKGY 512
            ||||.      :||.|   |..:...||....:..||.....|||.|||.:.:::..|.......
Mosquito     1 MLSNASCLFFFLIFVFFANSMPLVMTFPLETSVFVRERMNNWYSLKAYYFSKLVADFPFLILGPS 65

  Fly   513 VFLSVIYASIYYTRGFLLYLSMGFLMSLSAVAAVGYGVFLSSLFESDKMASECAAPFDL-IF--- 573
            |||    |..||.....:.|..  ::.|.::.     :|.|.:.:...:.:....|.:| :|   
Mosquito    66 VFL----AGAYYLTSQPMELDR--IVMLWSIC-----IFTSWIAQMTGLLAGSVLPLELSVFCVP 119

  Fly   574 ------LIFGGTYMN----VDTVPGLKYLSLFFYSNEALMYKFWIDIDNIDCPVNEDHPCIKTGV 628
                  |||.|.::.    .|.:....|::.|.||.|..|...: ..|..:.|.:.|. |..:.|
Mosquito   120 CSVIPMLIFCGFFVRFREMFDFLIPFTYVAYFRYSFEGAMQAIY-GFDRANLPCSGDF-CYFSKV 182

  Fly   629 EVLQQGSYRNADYTYWLDCFSLVVVAVIFHI 659
            ..... |:...:.|:.:|...|:....:.|:
Mosquito   183 PKFLD-SFDMLENTFVMDVCGLLGWIFVLHV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bwNP_001286769.1 P-loop_NTPase 31..316 CDD:304359
3a01204 40..673 CDD:273361 53/226 (23%)
ABC2_membrane 404..604 CDD:279410 42/169 (25%)
AgaP_AGAP009470XP_559779.3 ABC2_membrane <18..161 CDD:279410 36/153 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0061
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.