DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bw and Abca4

DIOPT Version :9

Sequence 1:NP_001286769.1 Gene:bw / 37724 FlyBaseID:FBgn0000241 Length:675 Species:Drosophila melanogaster
Sequence 2:NP_001101191.1 Gene:Abca4 / 310836 RGDID:1309445 Length:2290 Species:Rattus norvegicus


Alignment Length:396 Identity:90/396 - (22%)
Similarity:145/396 - (36%) Gaps:124/396 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GDLIAILGGSGAGKTTLLAAISQRLRGNLT---GDVVLNGMAMERHQMTRIS------SFLPQFE 114
            |:...:||.:||||||..    :.|.|:.|   ||..:.|.::    :|.||      .:.|||:
  Rat  1942 GECFGLLGVNGAGKTTTF----KMLTGDTTVTSGDATIAGKSI----LTNISDVHQNMGYCPQFD 1998

  Fly   115 INVKTFTAYEHLYFMSHFKMHRRTTKAEKRQRVADL-LLAVGLRDAAHTRIQQLSGGERKRLSLA 178
            ......|..||||..:..    |...:::.::||:. :.::||...|.......|||.:::||.|
  Rat  1999 AIDDLLTGREHLYLYARL----RGVPSKEIEKVANWGIQSLGLSLYADRLAGTYSGGNKRKLSTA 2059

  Fly   179 EELITDPIFLFCDEPTTGLDSFSA----YSVIKTLRH----------------LCTRRRIAKHSL 223
            ..|...|..|..||||||:|..:.    .:::..:|.                ||||..|.....
  Rat  2060 IALTGCPPLLLLDEPTTGMDPQARRMLWNTIVNIIRQGRAVVLTSHSMEECEALCTRLAIMVKGT 2124

  Fly   224 NQVYGE---------DSF------ETPSG---------ESSASGSGSKSIEMEVVAESHESLLQT 264
            .|..|.         |.:      ::|..         |....|:...|::    .|.|.|:|| 
  Rat  2125 FQCMGTIQHLKYKFGDGYIVTMKIKSPKDDLLPDLNPVEQFFQGNFPGSVQ----RERHHSMLQ- 2184

  Fly   265 MRELPALGVLSNSPNGTHKKAAICSIHQPTSDIFELFTHIILMDGGRIVYQGRTEQA-------- 321
                                     ...|:|.:..:|..:|......::.:....|.        
  Rat  2185 -------------------------FQVPSSSLARIFQLLISHKDSLLIEEYSVTQTTLDQVFVN 2224

  Fly   322 -AKFFTDLGYELPLNCNPADFYLKTLADKEGKENAGAVLRAKYEHETDGLYSGSWLLARSYSGDY 385
             ||..|:. |:|||:                ...|||..:||.|.::..|.:...|.|.  |.::
  Rat  2225 FAKQQTET-YDLPLH----------------PRAAGASWQAKLEGKSGRLETQEPLPAG--SSEH 2270

  Fly   386 LKHVQN 391
            |.::.|
  Rat  2271 LANINN 2276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bwNP_001286769.1 P-loop_NTPase 31..316 CDD:304359 70/310 (23%)
3a01204 40..673 CDD:273361 90/396 (23%)
ABC2_membrane 404..604 CDD:279410
Abca4NP_001101191.1 rim_protein 1..2249 CDD:130324 81/365 (22%)
ABC_subfamily_A 907..1126 CDD:213230
ABC_subfamily_A 1915..2135 CDD:213230 56/204 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.