DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bw and Abca7

DIOPT Version :9

Sequence 1:NP_001286769.1 Gene:bw / 37724 FlyBaseID:FBgn0000241 Length:675 Species:Drosophila melanogaster
Sequence 2:NP_997481.1 Gene:Abca7 / 299609 RGDID:1303134 Length:2170 Species:Rattus norvegicus


Alignment Length:313 Identity:80/313 - (25%)
Similarity:114/313 - (36%) Gaps:87/313 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GDLIAILGGSGAGKTTLLAAISQRLRGNL---TGDVVLNG--MAMERHQMTRISSFLPQFEINVK 118
            |:...:||.:|||||:....::    |:.   :|:.||.|  :|.|.....|...:.||.:....
  Rat  1845 GECFGLLGVNGAGKTSTFRMVT----GDTLPSSGEAVLAGHNVAQEPSAAHRSMGYCPQSDAIFD 1905

  Fly   119 TFTAYEHLYFMSHFKMHRRTTKAEKRQRVADLLLAVGLRDAAHTRIQQLSGGERKRLSLAEELIT 183
            ..|..|||..   |...|...:|:..|.....|:.:||...|.......|||.:::|:.|..|:.
  Rat  1906 LLTGREHLEL---FARLRGVPEAQVAQTALSGLVRLGLPSYADRPAGTYSGGNKRKLATALALVG 1967

  Fly   184 DPIFLFCDEPTTGLDSFSAYSVIKTLRHLCTRRRIAKHSLNQVYGEDSFETPSGESSASGSGSKS 248
            ||..:|.||||||:|.              :.||...::|..|..|       |.|         
  Rat  1968 DPAVVFLDEPTTGMDP--------------SARRFLWNNLLSVVRE-------GRS--------- 2002

  Fly   249 IEMEVVAESHESLLQTMRELPALGVLSNSPNGTHKKAAICSIHQPTSDIFELFTHIILMDGGRIV 313
                ||..||     :|.|..||                |             |.:.:|..||..
  Rat  2003 ----VVLTSH-----SMEECEAL----------------C-------------TRLAIMVNGRFR 2029

  Fly   314 YQGRTEQAAKFFTDLGYELPLNCNPAD------FYLKTLADKEGKENAGAVLR 360
            ..|..:.....| ..|:.|.|...|..      |.:.|..|.|.:|..|:.||
  Rat  2030 CLGSAQHLKSRF-GAGHTLTLRVPPDQPEPAIAFIVTTFPDAELREVHGSRLR 2081

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bwNP_001286769.1 P-loop_NTPase 31..316 CDD:304359 66/261 (25%)
3a01204 40..673 CDD:273361 80/313 (26%)
ABC2_membrane 404..604 CDD:279410
Abca7NP_997481.1 rim_protein 1..2127 CDD:130324 80/313 (26%)
ABC2_membrane <557..742 CDD:304374
ABC_subfamily_A 805..1024 CDD:213230
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1044..1086
ABC_subfamily_A 1818..2038 CDD:213230 67/267 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2129..2170
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.