DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bw and Abca7

DIOPT Version :9

Sequence 1:NP_001286769.1 Gene:bw / 37724 FlyBaseID:FBgn0000241 Length:675 Species:Drosophila melanogaster
Sequence 2:NP_001334010.1 Gene:Abca7 / 27403 MGIID:1351646 Length:2167 Species:Mus musculus


Alignment Length:361 Identity:84/361 - (23%)
Similarity:138/361 - (38%) Gaps:81/361 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GDLIAILGGSGAGKTTLLAAISQRL-----RGNLTGDVVLNGMAMERHQMTRISSFLPQFEINVK 118
            |.:.|.||.:||||||.|:.:|...     ..::.|..|...||..|..:    ...||:.:...
Mouse   831 GHITAFLGHNGAGKTTTLSILSGLFPPSSGSASILGHDVQTNMAAIRPHL----GICPQYNVLFD 891

  Fly   119 TFTAYEHLYFMSHFKMHRRTTKAEKRQRVADLLLAVGLRDAAHTRIQQLSGGERKRLSLAEELIT 183
            ..|..||::|....|.........:|:|   |:..|||.....|:.:.||||.:::||:|...:.
Mouse   892 MLTVEEHVWFYGRLKGVSAAAMGPERER---LIRDVGLTLKRDTQTRHLSGGMQRKLSVAIAFVG 953

  Fly   184 DPIFLFCDEPTTGLDSFS-------------AYSVIKTLRHL--------------------C-- 213
            ....:..||||.|:|..|             ..::|.:..||                    |  
Mouse   954 GSRVVIMDEPTAGVDPASRRGIWELLLKYREGRTLILSTHHLDEAELLGDRVAMVAGGSLCCCGS 1018

  Fly   214 ---TRRRI----------AKHSLNQVYGEDSFETPSGESSASGSGSKSIEMEVVAESHESLLQTM 265
               .||.:          :..||.....:...|.|..|..:.|:|..|........|.:|     
Mouse  1019 PLFLRRHLGCGYYLTLVKSSQSLVTHDAKGDSEDPRREKKSDGNGRTSDTAFTRGTSDKS----- 1078

  Fly   266 RELPALGVLSNSPNGTHKKAAICSIHQPTSDIFELFTHIILMDGGRIVYQGRTEQA-AKFFTDLG 329
            .:.||.|.:..:|: |.:...:...|.|.:.:.|...|.:|:   .:.|.|..:.: |..|.:|.
Mouse  1079 NQAPAPGAVPITPS-TARILELVQQHVPGAQLVEDLPHELLL---VLPYAGALDGSFAMVFQELD 1139

  Fly   330 YELPL---------NCNPADFYLKTLAD--KEGKEN 354
            .:|.|         :.|..:.:||.:.|  :||.::
Mouse  1140 QQLELLGLTGYGISDTNLEEIFLKVVEDAHREGGDS 1175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bwNP_001286769.1 P-loop_NTPase 31..316 CDD:304359 72/309 (23%)
3a01204 40..673 CDD:273361 84/361 (23%)
ABC2_membrane 404..604 CDD:279410
Abca7NP_001334010.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1042..1088 11/50 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1172..1192 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2126..2167
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.