DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bw and Abca4

DIOPT Version :9

Sequence 1:NP_001286769.1 Gene:bw / 37724 FlyBaseID:FBgn0000241 Length:675 Species:Drosophila melanogaster
Sequence 2:NP_031404.1 Gene:Abca4 / 11304 MGIID:109424 Length:2310 Species:Mus musculus


Alignment Length:392 Identity:89/392 - (22%)
Similarity:143/392 - (36%) Gaps:128/392 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 MKTGDLIAILGGSGAGKTTLLAAISQRLRGNLT---GDVVLNGMAMERHQMTRIS------SFLP 111
            ::.|:...:||.:||||||..    :.|.|:.|   ||..:.|.::    :|.||      .:.|
Mouse  1961 VRPGECFGLLGVNGAGKTTTF----KMLTGDTTVTSGDATVAGKSI----LTSISDVHQNMGYCP 2017

  Fly   112 QFEINVKTFTAYEHLYFMSHFKMHRRTTKAEKRQRVADL-LLAVGLRDAAHTRIQQLSGGERKRL 175
            ||:......|..||||..:..    |...:::.::||:. :.::||...|.......|||.:::|
Mouse  2018 QFDAIDDLLTGREHLYLYARL----RGVPSKEIEKVANWGIQSLGLSLYADRLAGTYSGGNKRKL 2078

  Fly   176 SLAEELITDPIFLFCDEPTTGLDSFSA----YSVIKTLRH----------------LCTRRRIAK 220
            |.|..|...|..|..||||||:|..:.    .:::..:|.                ||||..|..
Mouse  2079 STAIALTGCPPLLLLDEPTTGMDPQARRMLWNTIVSIIREGRAVVLTSHSMEECEALCTRLAIMV 2143

  Fly   221 HSLNQVYGE---------DSF------ETPSG---------ESSASGSGSKSIEMEVVAESHESL 261
            ....|..|.         |.:      ::|..         |....|:...|::    .|.|.|:
Mouse  2144 KGTFQCLGTIQHLKYKFGDGYIVTMKIKSPKDDLLPDLNPVEQFFQGNFPGSVQ----RERHHSM 2204

  Fly   262 LQTMRELPALGVLSNSPNGTHKKAAICSIHQPTSDIFELFTHIILMDGGRIVYQGRTEQA----- 321
            ||                          ...|:|.:..:|..:|......::.:....|.     
Mouse  2205 LQ--------------------------FQVPSSSLARIFQLLISHKDSLLIEEYSVTQTTLDQV 2243

  Fly   322 ----AKFFTDLGYELPLNCNPADFYLKTLADKEGKENAGAVLRAKYEHET------DGLYSGSWL 376
                ||..|:. |:|||:                ...|||..:||.|.::      :.|.:||..
Mouse  2244 FVNFAKQQTET-YDLPLH----------------PRAAGASWQAKLEEKSGRLQTQEPLPAGSEQ 2291

  Fly   377 LA 378
            ||
Mouse  2292 LA 2293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bwNP_001286769.1 P-loop_NTPase 31..316 CDD:304359 70/313 (22%)
3a01204 40..673 CDD:273361 89/392 (23%)
ABC2_membrane 404..604 CDD:279410
Abca4NP_031404.1 rim_protein 1..2271 CDD:130324 81/368 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 891..910
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1311..1344
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2266..2310 9/28 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.