DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bw and AgaP_AGAP013384

DIOPT Version :9

Sequence 1:NP_001286769.1 Gene:bw / 37724 FlyBaseID:FBgn0000241 Length:675 Species:Drosophila melanogaster
Sequence 2:XP_003436017.1 Gene:AgaP_AGAP013384 / 11175676 VectorBaseID:AGAP013384 Length:791 Species:Anopheles gambiae


Alignment Length:232 Identity:48/232 - (20%)
Similarity:76/232 - (32%) Gaps:83/232 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 GEDSFETPSG----ESSASGSGSKSIEM----EVVAESHESLLQTM----------RELP----- 269
            |.:|..:||.    .||.|||.:.:.|.    .||.....|:.|.:          .|||     
Mosquito    39 GSESSSSPSAPSSISSSTSGSSASTCEAASPPAVVTGQPPSVAQVLYMPVGLANIKEELPEPEIQ 103

  Fly   270 ------------ALGVLSNSPN--------------GTHKKAAICSIHQPTSDIFELFTHIILMD 308
                        .:.||.::||              |...|    |..:.|||.:.....::.:.
Mosquito   104 ADSELSLEEGHALVQVLEDTPNDEAPPPEPEVEIRAGKADK----SFRKLTSDGYPAKGAVVRLQ 164

  Fly   309 GGRIVYQGRTEQAAKFFTDLGYELPLNCNPADFYLKTLADKEGKENAGAVLRAKYEHETDG---- 369
            .|::.|| .|:|..|.........||... .|...:.::||:.:      |..:..|..:.    
Mosquito   165 MGKVTYQ-LTDQMLKSGALAAMHNPLLLT-KDQLERMISDKDPE------LEYRKHHNNNSTWQR 221

  Fly   370 ----LYSG-----------SWLL---ARSYSGDYLKH 388
                .|.|           .||:   |.:.:|..|:|
Mosquito   222 YMPMYYKGIKQNYVRCLECGWLVLHKASTGTGSLLRH 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bwNP_001286769.1 P-loop_NTPase 31..316 CDD:304359 29/136 (21%)
3a01204 40..673 CDD:273361 48/232 (21%)
ABC2_membrane 404..604 CDD:279410
AgaP_AGAP013384XP_003436017.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0061
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1022017at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.