DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment seq and NTO1

DIOPT Version :9

Sequence 1:NP_001027415.1 Gene:seq / 3772396 FlyBaseID:FBgn0028991 Length:882 Species:Drosophila melanogaster
Sequence 2:NP_015356.1 Gene:NTO1 / 856143 SGDID:S000006235 Length:748 Species:Saccharomyces cerevisiae


Alignment Length:186 Identity:33/186 - (17%)
Similarity:68/186 - (36%) Gaps:52/186 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   607 TTTLIYSNQLELQQALLQQ---QLQGQSIMIQDQAGNLVPLQLDGTQAIYTTAPQAQRQQTTATY 668
            |..||:..::..:..:|::   :.|...|...:..|...|..:...::..:......:.:...:|
Yeast    68 TKELIFKGRVTTEPLVLKKNEVEFQKCKITTNELKGKKNPYCVRFNESFISRYYHINKVRNRKSY 132

  Fly   669 QTTQQQQQQPAQQPAGQAQQQPHY------ELDNVTYLSSTAAATPTSAEQQQQQQQQQHVIGTV 727
               :|||::      ....:.|::      |..|:|..:||.:|                    :
Yeast   133 ---KQQQKE------FDGVEAPYFTKFSSKEAPNITISTSTKSA--------------------I 168

  Fly   728 QSYQILTPDGLQNFQPKLETAELGDLCPYSQYTFTTHAGAQPTLNANALDAQTQHQ 783
            |.:..::|: |.||:|:.:..|..:|  |..|           ||......|..|:
Yeast   169 QKFASISPN-LVNFKPQYDMDEQDEL--YLHY-----------LNKRYFKDQMSHE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seqNP_001027415.1 C2H2 Zn finger 404..430 CDD:275370
NTO1NP_015356.1 COG5141 18..748 CDD:227470 33/186 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.