DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment seq and Phf14

DIOPT Version :9

Sequence 1:NP_001027415.1 Gene:seq / 3772396 FlyBaseID:FBgn0028991 Length:882 Species:Drosophila melanogaster
Sequence 2:XP_006505259.1 Gene:Phf14 / 75725 MGIID:1923539 Length:946 Species:Mus musculus


Alignment Length:353 Identity:58/353 - (16%)
Similarity:127/353 - (35%) Gaps:95/353 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KSSQGQQQQIVYVNMLPAANTLNGIPQQQQQQQYASTDGNVYQLQNEILCDANGH-AVTAATASY 97
            :||:.:|.:.:..::|.|.:             |.|:|.:.:::.:....:.:|: :...:..|.
Mouse     3 RSSKRRQVKPLAASLLEALD-------------YDSSDDSDFKVGDASDSEGSGNGSEDPSKDSG 54

  Fly    98 QTTASSPQQQ----------QQQQQQQQNVATSVADNVVTTISSSSILHTNANTNGVDTLAATQQ 152
            :.:.|..::.          |.:::|.:|....:..:....|....   .....||.......::
Mouse    55 EGSCSDSEENILEEELNEDIQVKEEQLKNSTEEIMPSDKQLIKMEK---KEEEENGERPRKKKEK 116

  Fly   153 QQQQQQQQQQQQQQQHYHYITTTGEDGQTPTTIVFENYNGGMPAVSSAAPTPVPVSQANAPATTT 217
            ::::::::::.:::............|.||.|                  :|..|:..:.|.|||
Mouse   117 EKEKEKEREKDKEKATVSDSAAASAAGTTPAT------------------SPPAVTSPSVPTTTT 163

  Fly   218 TTALVNTDGTIIE------------FDGSTYEEYHVLKSEPGSSD-------CLSNGSSAVAADI 263
            ||    |:..:.|            .|..:.||.:.:.......|       ....|.||     
Mouse   164 TT----TEEQVSEPKKWNLRRNRPLLDFVSMEELNAMDDYDSEDDNDWRPTVVKRKGRSA----- 219

  Fly   264 IKYDPQHGVVGDEEDDDENGMLHVKYEEQSLEHDPENEHDAEQEHE--------YEEYQVIKAEV 320
               ..:.|..||.||||:.|         |...:.||:...:::|.        .::...:.:..
Mouse   220 ---SQKEGSDGDNEDDDDEG---------SGSEEDENDEGNDEDHSSPASEAGGKKKRSKVLSRN 272

  Fly   321 EAEAAELAAGTTSYTISQEQTGSGNTVL 348
            .|:..||.  ..|.|:||.::...:.:|
Mouse   273 SADDEELT--NDSLTLSQSKSNEDSLIL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seqNP_001027415.1 C2H2 Zn finger 404..430 CDD:275370
Phf14XP_006505259.1 PHD1_PHF14 314..370 CDD:277036
ePHD_PHF14 378..491 CDD:277144
PHD2_PHF14 720..769 CDD:277037
PHD3_PHF14 863..911 CDD:277038
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.