DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment seq and Kdm4d

DIOPT Version :9

Sequence 1:NP_001027415.1 Gene:seq / 3772396 FlyBaseID:FBgn0028991 Length:882 Species:Drosophila melanogaster
Sequence 2:NP_001073180.1 Gene:Kdm4d / 689582 RGDID:1591045 Length:510 Species:Rattus norvegicus


Alignment Length:261 Identity:54/261 - (20%)
Similarity:82/261 - (31%) Gaps:96/261 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 YLFHEGQNRKI-------FACP------------ICNK---EFS--------RPDKMKMHKKDKH 461
            |.:|.|.|...       ||.|            .|.:   .||        :|::.:|.|:.: 
  Rat   274 YGYHAGFNHGFNCAEAINFATPRWIDYGKVASQCSCGEARVSFSMDAFVRILQPERYEMWKRGQ- 337

  Fly   462 GDVPMPPSATTTPLKADGPPAKRARTARTPRVRKTKDGSTPTKK------RLAQIDSVLDDVQNG 520
                  ..|.....:|.||.::...|.|..:        .|.|.      ||.|:...|..|...
  Rat   338 ------DQAVVDHTEAMGPTSQELTTWRVIQ--------APRKTWGLKHLRLRQVSRCLLPVATD 388

  Fly   521 ESLTMAPVSVSHSQQQ----QQQQIQHSITTLAPSTPSQPQHQLQTLPSLDFSGMILPGGAQLAL 581
            .::. ....:.|:.:|    :..::|.|...:||..|                         |.|
  Rat   389 SNIA-NNTQMCHTSRQAADSKGDEVQESDPAIAPPYP-------------------------LGL 427

  Fly   582 ANPG--ATSSVGLQRGPA------TPNGQPAP---PTTTLIYSNQLELQQALLQQQLQGQSIMIQ 635
            ::||  :|...||.|.|.      :.||.|..   |......|...|||    .|.:.|..|:..
  Rat   428 SSPGHMSTGKRGLGRRPCELGVQESTNGAPVKRRLPEGRDDRSPSPELQ----SQSVTGDLIVNS 488

  Fly   636 D 636
            |
  Rat   489 D 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seqNP_001027415.1 C2H2 Zn finger 404..430 CDD:275370 1/2 (50%)
Kdm4dNP_001073180.1 JmjN 15..55 CDD:128818
JmjC 176..292 CDD:202224 4/17 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..510 28/122 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.