DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment seq and Phf14

DIOPT Version :9

Sequence 1:NP_001027415.1 Gene:seq / 3772396 FlyBaseID:FBgn0028991 Length:882 Species:Drosophila melanogaster
Sequence 2:XP_006236166.1 Gene:Phf14 / 500030 RGDID:1563764 Length:950 Species:Rattus norvegicus


Alignment Length:351 Identity:58/351 - (16%)
Similarity:131/351 - (37%) Gaps:92/351 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KSSQGQQQQIVYVNMLPAANTLNGIPQQQQQQQYASTDGNVYQLQNEILCDANGH-AVTAATASY 97
            :||:.:|.:.:..::|.|.:             |.|:|.:.:::.:....:.:|: :...:..|.
  Rat     3 RSSKRRQVKPLAASLLEALD-------------YDSSDDSDFKVGDASDSEGSGNGSEDPSKDSG 54

  Fly    98 QTTASSPQQQQQQQQQQQNVATSVAD--NVVTTISSS-----SILHTNANTNGVDTLAATQQQQQ 155
            :.:.|..::...:::..:::......  |....|.||     .:.......||.......:::::
  Rat    55 EGSCSDSEENILEEELNEDIKVKEEQLRNSTEEIMSSDKQLIKMEKKEEEENGERPRKRKEKEKE 119

  Fly   156 QQQQQQQQQQQQHYHYITTTGEDGQTPTTIVFENYNGGMPAVSSAAPTPVPVSQANAPATTTTTA 220
            :::::::.:::............|.||.|        ..|||:|.|          .|.|||:: 
  Rat   120 KEKEREKDKEKATVSDSAAASAAGTTPAT--------SPPAVTSPA----------VPTTTTSS- 165

  Fly   221 LVNTDGTIIEFDGSTYEEYHVLKSEPGSSDCLSNGSSAVAADIIKYDPQ---------------- 269
                     |...|..:::::.::.|    .|...|.....|:..||.:                
  Rat   166 ---------EEQVSEPKKWNLRRNRP----LLDFVSMEELNDMDDYDSEDDNDWRPTVVKRKGRS 217

  Fly   270 ----HGVVGDEEDDDENGMLHVKYEEQSLEHDPENEHDAEQEHE--------YEEYQVIKAEVEA 322
                .|..||.||||:.|         |...:.||:...:::|.        .::...:.:...|
  Rat   218 ASQKEGSDGDNEDDDDEG---------SGSEEDENDEGNDEDHSSPASEAGGKKKKSKVLSRNSA 273

  Fly   323 EAAELAAGTTSYTISQEQTGSGNTVL 348
            :..||.  ..|.|:||.::...:.:|
  Rat   274 DDEELT--NDSLTLSQSKSNEDSLIL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seqNP_001027415.1 C2H2 Zn finger 404..430 CDD:275370
Phf14XP_006236166.1 PHD1_PHF14 313..369 CDD:277036
ePHD_PHF14 377..490 CDD:277144
PHD2_PHF14 719..768 CDD:277037
PHD3_PHF14 862..920 CDD:277038
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.