DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment seq and Kdm4d

DIOPT Version :9

Sequence 1:NP_001027415.1 Gene:seq / 3772396 FlyBaseID:FBgn0028991 Length:882 Species:Drosophila melanogaster
Sequence 2:NP_775609.2 Gene:Kdm4d / 244694 MGIID:3606484 Length:510 Species:Mus musculus


Alignment Length:242 Identity:46/242 - (19%)
Similarity:77/242 - (31%) Gaps:86/242 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 YLFHEGQNRKI-------FACP------------ICNK---EFS--------RPDKMKMHKKDK- 460
            |.:|.|.|...       ||.|            .|.:   .||        :|::.::.|:.: 
Mouse   274 YGYHAGFNHGFNCAEAINFATPRWIDYGKVASQCSCGEARVSFSMDAFVRILQPERYELWKRGQD 338

  Fly   461 -----HGDVPMPPSATTTPLKADGPPAKRARTARTPRVRKTKDGSTPTKKRLAQIDSVL------ 514
                 |.:..:..|...|..:....|.|.....|. |:|:......|    :|.:.:|.      
Mouse   339 QAVVDHTETMVSTSQELTTRRVTKAPRKTWGLKRL-RLRQVSRSLLP----IATVSNVPCNMQVC 398

  Fly   515 -----------DDVQNGESLTMAPVSVS-----HSQQQQ---------------------QQQIQ 542
                       ||||..:|...:|..:|     |...::                     ::|:.
Mouse   399 HTSRQPSDVKGDDVQKSDSARASPHPLSLPSSGHMSTRRCSLGRRPCELGAQESSNGAPVKRQLP 463

  Fly   543 HSITTLAPSTPSQPQHQLQTLPSLDFSGMILPGGAQLALANPGATSS 589
            ......:||...|||.....|  :..||::.||...|..|:.|..:|
Mouse   464 AGRDDTSPSPELQPQAVSGDL--IVDSGLVNPGPQHLMTASEGGLTS 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seqNP_001027415.1 C2H2 Zn finger 404..430 CDD:275370 1/2 (50%)
Kdm4dNP_775609.2 JmjN 15..55 CDD:128818
JmjC 176..292 CDD:334913 4/17 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..510 23/114 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.