DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment seq and JADE2

DIOPT Version :9

Sequence 1:NP_001027415.1 Gene:seq / 3772396 FlyBaseID:FBgn0028991 Length:882 Species:Drosophila melanogaster
Sequence 2:NP_001276914.1 Gene:JADE2 / 23338 HGNCID:22984 Length:850 Species:Homo sapiens


Alignment Length:370 Identity:70/370 - (18%)
Similarity:122/370 - (32%) Gaps:106/370 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 DDDENGMLHVKYEEQSLEHD---PENEHDAE---------------------QEHEYEEYQVIKA 318
            |:||     ||::....||.   |.||..:|                     |:.|.:.|::::.
Human   367 DNDE-----VKFKSFCQEHSDGGPRNEPTSEPTEPSQAGEDLEKVTLRKQRLQQLEEDFYELVEP 426

  Fly   319 EVEAEAAELAAGTTSYTISQ---EQTGSGNTVLSSMVPKSGSAAAAKQKRK----RKTRVIADDE 376
            ...||..:||.....:....   ::..:.|..|  :.||:.......|:.:    |:.::.....
Human   427 AEVAERLDLAEALVDFIYQYWKLKRKANANQPL--LTPKTDEVDNLAQQEQDVLYRRLKLFTHLR 489

  Fly   377 QGEYLEKMSVRGLDIARYEHIIDGVAYCLVCAKNDIFKTFKNKYSF-QRHAYLFHEGQNRKIFAC 440
            |            |:.|..::      |.:..:.:     :.|::. :....:||  ...|:...
Human   490 Q------------DLERVRNL------CYMVTRRE-----RTKHAICKLQEQIFH--LQMKLIEQ 529

  Fly   441 PICNKEFSRPDKMKMHKKDKHGDVPMPPSATTTPLKADGPPAKRARTARTPRVRKTKDGSTPTKK 505
            .:|.:...|..|.|.....:.|              .:|                 ..|||..|:
Human   530 DLCRERSGRRAKGKKSDSKRKG--------------CEG-----------------SKGSTEKKE 563

  Fly   506 RL-AQIDSVLDDVQNGESLTMAPVSVSHSQQQQQQQIQHSITTLAPST-PSQPQHQLQTLPSLDF 568
            :: |..||||..:. |.| |..|:..:.......|.:|.:...:|.|. |....|:....|.|..
Human   564 KVKAGPDSVLGQLA-GLS-TSFPIDGTFFNSWLAQSVQITAENMAMSEWPLNNGHREDPAPGLLS 626

  Fly   569 SGMILPGGAQLAL-----ANPG--ATSSVGLQRGPATPNGQPAPP 606
            ..::......|:.     ..||  |..:.|..|.||.....|.||
Human   627 EELLQDEETLLSFMRDPSLRPGDPARKARGRTRLPAKKKPPPPPP 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seqNP_001027415.1 C2H2 Zn finger 404..430 CDD:275370 2/26 (8%)
JADE2NP_001276914.1 EPL1 <153..191 CDD:287484
PHD_JADE2 217..262 CDD:277150
ePHD_JADE2 270..380 CDD:277175 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.