DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11566 and CACNG8

DIOPT Version :9

Sequence 1:NP_001027081.1 Gene:CG11566 / 3772393 FlyBaseID:FBgn0031159 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_114101.4 Gene:CACNG8 / 59283 HGNCID:13628 Length:425 Species:Homo sapiens


Alignment Length:171 Identity:40/171 - (23%)
Similarity:54/171 - (31%) Gaps:71/171 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 PPHGILRSGNSRLHQVYDAGRGHPGMTGQIGHS-----GQTQTLPGACRKHPNAGSNLNLYLHND 159
            |..|.:.:|      :..||.|..|..|..|.:     |......||..:....|::..|.||| 
Human   313 PSKGSVAAG------LAGAGGGGGGAVGAFGGAAGGAGGGGGGGGGAGAERDRGGASGFLTLHN- 370

  Fly   160 LERRFYFEKPAVSKCNLHSRSFAKSLNELCTDTSVSSTHVPAPLLPSAADPLPAPALFADLPQEF 224
                                :|.|   |.....:|:.|..|||         ||||         
Human   371 --------------------AFPK---EAGGGVTVTVTGPPAP---------PAPA--------- 394

  Fly   225 PLTRSVSTATEIYPASSSAPAPPSAQMKRKQQRNMATNTNT 265
                         |.:.|||||.:.     .:...|:||||
Human   395 -------------PPAPSAPAPGTL-----AKEAAASNTNT 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11566NP_001027081.1 None
CACNG8NP_114101.4 PMP22_Claudin 17..223 CDD:304458
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..304
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 343..365 4/21 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 377..425 20/77 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M76
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.