DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11566 and stg-1

DIOPT Version :9

Sequence 1:NP_001027081.1 Gene:CG11566 / 3772393 FlyBaseID:FBgn0031159 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001021976.1 Gene:stg-1 / 3564873 WormBaseID:WBGene00007670 Length:366 Species:Caenorhabditis elegans


Alignment Length:155 Identity:36/155 - (23%)
Similarity:58/155 - (37%) Gaps:33/155 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 IYYISGGDEAEEEEQEDQA--KREEVPDDPHRDDDDDADGDDHGFRQFNRMEEEHLYVVGDH--A 375
            :.|::..||......:.:|  ..::.|||   ||...:...:....:|||.       .|.|  |
 Worm   225 VVYMAKRDERTFNRYKIRATFNLQKKPDD---DDRQLSILTESSNTRFNRR-------TGSHTTA 279

  Fly   376 QLVVPRRTSMC-VDSMGQPLRR----LNSNLSLHTD----LSFPGTGG----YPGMRMSLPQPAD 427
            ....|...||. ..|..:.|::    :..:.||..:    |......|    |.|.|.::.:|..
 Worm   280 DSPPPELDSMIKAPSSDRALQKYKTGIQGSFSLLAESFNHLPEQSRSGSEISYNGRRSTIRKPPK 344

  Fly   428 LGQSRTLPRCFLRQSSDSLASQGYP 452
            ..:|:.|.|..:.      .|||||
 Worm   345 PSKSQPLRRFAIP------VSQGYP 363



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M76
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.