DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11566 and stg1

DIOPT Version :9

Sequence 1:NP_001027081.1 Gene:CG11566 / 3772393 FlyBaseID:FBgn0031159 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001027082.1 Gene:stg1 / 318064 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster


Alignment Length:145 Identity:36/145 - (24%)
Similarity:49/145 - (33%) Gaps:49/145 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FSVANIHAKLKEGQH----PLSDSYKRYKQPGI------TTASQEGLSSAGQGQQGHQS------ 87
            |.||:.|:...|..:    |.:......::|.|      |:||.|....:.|.|...|.      
  Fly    11 FRVASTHSINSENPYNNIRPANVICNTTERPPIAIHQLTTSASIEHSHPSQQAQHQQQQLLHHQQ 75

  Fly    88 --HHPTHQPHPTAQPPHGILRSGNSRL----HQVYDAGRGHPGMTGQIGHSGQTQTLPG---ACR 143
              ||..|.|:.|.  |.|      .||    ||                .:|...|:.|   |..
  Fly    76 QHHHQQHSPYATL--PRG------QRLAPQQHQ----------------QAGVINTISGSIPATG 116

  Fly   144 KHPNAGSNLNLYLHN 158
            ....|||..:|.|:|
  Fly   117 FSSLAGSFSDLQLNN 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11566NP_001027081.1 None
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M76
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.