DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11566 and D1007.8

DIOPT Version :9

Sequence 1:NP_001027081.1 Gene:CG11566 / 3772393 FlyBaseID:FBgn0031159 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_491405.2 Gene:D1007.8 / 172066 WormBaseID:WBGene00017005 Length:259 Species:Caenorhabditis elegans


Alignment Length:123 Identity:29/123 - (23%)
Similarity:45/123 - (36%) Gaps:26/123 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 TEIYPASSSAPAPPSAQMKRKQQRNMATNTNTKISNNPPSSNSQMADQSRLCGLKRGLRKTKDEL 298
            |.|.||.:|...|....:|.|          ....|..|..   |.:||..|....|:..|:.|.
 Worm   136 TPILPAGASTNVPTRFGLKNK----------VGSLNRFPMG---MLEQSSSCENNMGVWPTEIEQ 187

  Fly   299 FQEFCRRAGMRSKPKNIYYISGGDEAEEEEQEDQAKREEVPDDPHRDDDDDADGDDHG 356
            .......:|:..:..::...|..|..||:|:|:             ::||:.|..|.|
 Worm   188 LAAGISTSGLVKEESDVSEDSSDDSDEEDEEEE-------------EEDDEEDSFDKG 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11566NP_001027081.1 None
D1007.8NP_491405.2 RPA_2b-aaRSs_OBF_like 37..115 CDD:299125
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.