DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11566 and CACNG3

DIOPT Version :9

Sequence 1:NP_001027081.1 Gene:CG11566 / 3772393 FlyBaseID:FBgn0031159 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_006530.1 Gene:CACNG3 / 10368 HGNCID:1407 Length:315 Species:Homo sapiens


Alignment Length:117 Identity:26/117 - (22%)
Similarity:44/117 - (37%) Gaps:26/117 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 TEIYPASSSAPAPPSAQMKRKQQRNMATNTNTK----IS---NNPPSSNSQM----ADQSRLCGL 287
            :|....|:.|..||.....|::..:.:|...::    ||   :..||::..|    .|.|::. :
Human   213 SEFLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKIT-M 276

  Fly   288 KRGLRKTKDELFQEFCRRAGMRSKPKNIYYISGGDEAEEEEQEDQAKREEVP 339
            ...|...:|..|.:|     ..|.||         |.:|....:.|.|...|
Human   277 GTLLNSDRDHAFLQF-----HNSTPK---------EFKESLHNNPANRRTTP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11566NP_001027081.1 None
CACNG3NP_006530.1 PMP22_Claudin 6..196 CDD:419754
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M76
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.