DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11566 and cacng7a

DIOPT Version :9

Sequence 1:NP_001027081.1 Gene:CG11566 / 3772393 FlyBaseID:FBgn0031159 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_005159461.1 Gene:cacng7a / 100034540 ZFINID:ZDB-GENE-060503-814 Length:341 Species:Danio rerio


Alignment Length:227 Identity:52/227 - (22%)
Similarity:76/227 - (33%) Gaps:94/227 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YFHTYISLQRLPCFSVANIHAKLKEGQHPLSDSY---KRYKQPGITTASQEGLSSAGQGQQGHQS 87
            :||.:....    |:.|.....||||...:| .|   |||.:                 ::.::.
Zfish   170 FFHYHYGWS----FAFAASSFLLKEGAGVMS-VYLFMKRYAE-----------------EEMYRP 212

  Fly    88 HHPTHQP-------------HPTAQPPHGILRSGNS-------RLHQV----YDAGRG---HPGM 125
            |...::|             ||.:.||....|||:.       :|:|.    ...|.|   .|..
Zfish   213 HPALYRPRLSECSDYSGQYLHPDSWPPPQRGRSGSEVSSDISIQLNQTPLPPQTKGSGPSNPPSS 277

  Fly   126 TGQIGHSGQTQTLPGACRKHPNAGSNLNLYLHNDLERRFYFEKPAVSKCNLHSRSFAKSLNELCT 190
            :|.  .||.:..||      |.:.|:.:.|.|                 .:||            
Zfish   278 SGP--SSGASYHLP------PASSSSSSSYPH-----------------TIHS------------ 305

  Fly   191 DTSVSSTHVPAPLLPSAADP--LPAPALFADL 220
              |.||:|||.. ||.||.|  :|.|...|.:
Zfish   306 --SHSSSHVPQS-LPMAAPPSAVPPPRYHAHM 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11566NP_001027081.1 None
cacng7aXP_005159461.1 PMP22_Claudin 18..195 CDD:304458 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M76
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.