DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33700 and LOC5667832

DIOPT Version :10

Sequence 1:NP_001027121.3 Gene:CG33700 / 3772390 FlyBaseID:FBgn0053700 Length:175 Species:Drosophila melanogaster
Sequence 2:XP_001688234.2 Gene:LOC5667832 / 5667832 VectorBaseID:AGAMI1_000253 Length:192 Species:Anopheles gambiae


Alignment Length:81 Identity:20/81 - (24%)
Similarity:37/81 - (45%) Gaps:8/81 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LFNQTLDFCYYMRNPRAHPLIYMMHKVFMQASNINHSCPYDHDLIINEFIYKKNDLKDLPIPN-- 148
            |.|:|..||.::.||.:|.|..:.|:...:...|.:.||....|    :.|....:..:.:||  
Mosquito    93 LNNRTFSFCKFLGNPTSHRLAQIFHREMRRTGYIPNKCPIPPAL----YAYPGVRVSAMRLPNFF 153

  Fly   149 --GDYMIRVKVAFDKE 162
              .|:::.:.:...||
Mosquito   154 PEADFILDITIGEGKE 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33700NP_001027121.3 DUF1091 71..153 CDD:461928 18/70 (26%)
LOC5667832XP_001688234.2 None

Return to query results.
Submit another query.