DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33700 and LOC5667831

DIOPT Version :10

Sequence 1:NP_001027121.3 Gene:CG33700 / 3772390 FlyBaseID:FBgn0053700 Length:175 Species:Drosophila melanogaster
Sequence 2:XP_061512612.1 Gene:LOC5667831 / 5667831 VectorBaseID:AGAMI1_012005 Length:127 Species:Anopheles gambiae


Alignment Length:99 Identity:27/99 - (27%)
Similarity:49/99 - (49%) Gaps:15/99 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LFNQTLDFCYYMRNPRAHPLIYMMHKVFMQASNINHSCPYDHDLIINEFIYKKNDLKDLPIPN-- 148
            |:|||:|||.:::||..|||..::|:...:..|:...||    :.:|.:.:....:..:.:||  
Mosquito    29 LYNQTIDFCEFLKNPSVHPLGQIIHREVKRNGNMPRKCP----ITVNLYAFYGIPMSGIRLPNFF 89

  Fly   149 --GDYMIRVKVAFDKE-------YRTSIKIYAKR 173
              .|:|:::.|....|       |.|..:|...|
Mosquito    90 PEADFMLQISVGLASEMIYDGRLYGTIKRIQCSR 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33700NP_001027121.3 DUF1091 71..153 CDD:461928 20/70 (29%)
LOC5667831XP_061512612.1 None

Return to query results.
Submit another query.