DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33700 and CG14456

DIOPT Version :9

Sequence 1:NP_001027121.3 Gene:CG33700 / 3772390 FlyBaseID:FBgn0053700 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster


Alignment Length:65 Identity:15/65 - (23%)
Similarity:28/65 - (43%) Gaps:3/65 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KLYNVPIKSVDINVALYKKSNGYRPFLFNQTLDFCYYMRNPRAHPLIYMMHKVFMQASNINHSCP 124
            :|::|   .:.:.|.:..|.:.|.....|.||:.|..:......|:...:|....:..||..:||
  Fly    63 ELHDV---DIHVEVRITNKQDPYYNTNLNTTLNVCRILGFANKSPVGRFVHGFIREFGNIVETCP 124

  Fly   125  124
              Fly   125  124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33700NP_001027121.3 DUF1091 71..153 CDD:284008 13/54 (24%)
CG14456NP_001137998.1 DM8 82..189 CDD:214778 11/43 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448151
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.