DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33700 and CG12849

DIOPT Version :9

Sequence 1:NP_001027121.3 Gene:CG33700 / 3772390 FlyBaseID:FBgn0053700 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster


Alignment Length:166 Identity:47/166 - (28%)
Similarity:82/166 - (49%) Gaps:8/166 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WTLLWSIF-----VAGDFQLQNVICESFDNAITNFSRCEMKFIRRGVAAFYMVWKLYNVPIKSVD 70
            ||.| .||     :.|.|:..||:|...|....:|..|.:|.:.|......:..|::.:|:.:.:
  Fly     5 WTFL-LIFMSPMAIRGHFEFNNVVCLVRDRMFMDFEYCYLKSVNRTYKYLSLKTKMFRLPVDNCE 68

  Fly    71 INVALYKKSNGYRPFLFNQTLDFCYYMRNPRAHPLIYMMHKVFMQASNINHSCPYDHDLIINEF- 134
            ....|..:.|....:.|:..:|.|.:||: |.|.:...:::.|...||:||:||||||:::::. 
  Fly    69 TRFQLRMRENRRVLYNFDFKVDSCKFMRD-RKHVIANWVYQTFGPYSNLNHTCPYDHDIVLDKLP 132

  Fly   135 IYKKNDLKDLPIPNGDYMIRVKVAFDKEYRTSIKIY 170
            :...|.|....||:|.||:..........||.:.:|
  Fly   133 VQHLNKLVQSIIPDGRYMMNSTWMVAGIPRTDVILY 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33700NP_001027121.3 DUF1091 71..153 CDD:284008 26/82 (32%)
CG12849NP_611969.2 DM8 80..172 CDD:214778 28/90 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472252
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.840

Return to query results.
Submit another query.