DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33700 and CG13590

DIOPT Version :9

Sequence 1:NP_001027121.3 Gene:CG33700 / 3772390 FlyBaseID:FBgn0053700 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_611919.1 Gene:CG13590 / 37907 FlyBaseID:FBgn0035012 Length:193 Species:Drosophila melanogaster


Alignment Length:169 Identity:50/169 - (29%)
Similarity:90/169 - (53%) Gaps:22/169 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TLLWSIFVAGD---FQLQNVICESFDNAITNFSRCEMKFIRRGVAAFYMVWKLYNV----PIKSV 69
            :||.:....|:   .::.|.:|:|::.:......|.:|...|...:..:     ||    |.:::
  Fly    11 SLLVAYLSCGEAPYLKMTNAVCKSYNKSWVVVHYCRLKAYSRAKTSLNI-----NVTFVEPARNI 70

  Fly    70 DINVALYKKSNGYRPFLFNQTLDFCYYMR---NPRAHPLIYMMHKVFMQASNINHSCPYDHDLII 131
            .::....||:|||:||||:.|.|.|.:||   .|.|..:.||:..|    |.|||:|||:...::
  Fly    71 SVHFKTMKKANGYKPFLFDYTFDACEFMRRRNQPVAKIIWYMIRNV----STINHTCPYEGLQML 131

  Fly   132 NEFIYKKNDLKDLPIPNGDYMIRVKVAFDKEYRTSIKIY 170
            ::|  .|.|: .:|:|:|||::.|...||.:.:.:..:|
  Fly   132 SDF--HKVDI-PVPLPSGDYLLMVDWLFDGKTQFATNVY 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33700NP_001027121.3 DUF1091 71..153 CDD:284008 34/84 (40%)
CG13590NP_611919.1 DM8 83..171 CDD:214778 34/92 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472518
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.840

Return to query results.
Submit another query.