DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33700 and CG33919

DIOPT Version :9

Sequence 1:NP_001027121.3 Gene:CG33700 / 3772390 FlyBaseID:FBgn0053700 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster


Alignment Length:158 Identity:42/158 - (26%)
Similarity:75/158 - (47%) Gaps:18/158 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FQLQNVICESFDNAITNFSRCEMKFIRRGVAAF----YMVWKLYNVPIKSVDINVALYKK--SNG 81
            ::|:.:.|......::|.| |.:|.|...:|..    :|:..|:| ||    |.:.::.|  ||.
  Fly    24 YKLKKIECLVNRTRVSNVS-CHVKAINWNLAVVNMDCFMIVPLHN-PI----IRMQVFTKDYSNQ 82

  Fly    82 YRPFLFNQTLDFCYYMRNPRAHPLIYMMHKVFMQASNINHSCPYDHDLIINEFIYKKNDLKDLPI 146
            |:|||.:..:..|..:......|...:|.|:|.:.:|:|||||:...||..:.....:.|.  |.
  Fly    83 YKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFSGHLIARDGFLDTSLLP--PF 145

  Fly   147 PNGDYMIRVKV----AFDKEYRTSIKIY 170
            |.|.|.:.:.|    :...:|..::|.:
  Fly   146 PQGFYQVSLVVTDTNSTSTDYVGTMKFF 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33700NP_001027121.3 DUF1091 71..153 CDD:284008 26/83 (31%)
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 26/83 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472519
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.840

Return to query results.
Submit another query.