DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33700 and CG33773

DIOPT Version :10

Sequence 1:NP_001027121.3 Gene:CG33700 / 3772390 FlyBaseID:FBgn0053700 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027213.1 Gene:CG33773 / 3772436 FlyBaseID:FBgn0053773 Length:179 Species:Drosophila melanogaster


Alignment Length:74 Identity:19/74 - (25%)
Similarity:28/74 - (37%) Gaps:25/74 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 WTDVIAEHEKDVLSTASAVNGDQLVVSYMSDVKHILQIRDLKSGSLLHGLPVDIGSVCGVFARRK 242
            |.:|....:..|      ||||||:...:|.::   :|.|..      |:...|||         
  Fly   292 WLEVFPREQLLV------VNGDQLIDDPVSQLR---RIEDFL------GIEPRIGS--------- 332

  Fly   243 DTTFFFRFT 251
             ..|:|..|
  Fly   333 -NNFYFNET 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33700NP_001027121.3 DUF1091 71..153 CDD:461928
CG33773NP_001027213.1 DUF1091 73..158 CDD:461928
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.