DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33700 and CG33784

DIOPT Version :9

Sequence 1:NP_001027121.3 Gene:CG33700 / 3772390 FlyBaseID:FBgn0053700 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027169.1 Gene:CG33784 / 3772181 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster


Alignment Length:167 Identity:53/167 - (31%)
Similarity:99/167 - (59%) Gaps:8/167 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LWSIFV----AGD----FQLQNVICESFDNAITNFSRCEMKFIRRGVAAFYMVWKLYNVPIKSVD 70
            |||..|    ..|    |:.:||.|..::.:.....|||:|.:.||:....:..::|.:||||..
  Fly    10 LWSYVVINLLLSDSNALFKFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNLHAQVYKLPIKSTT 74

  Fly    71 INVALYKKSNGYRPFLFNQTLDFCYYMRNPRAHPLIYMMHKVFMQASNINHSCPYDHDLIINEFI 135
            ..:.|:::.:||||||||.|:|.|:::::.:.:|...:::......||:||:||::||:|:|:.:
  Fly    75 CVLTLFRRFSGYRPFLFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPFNHDIIVNQMV 139

  Fly   136 YKKNDLKDLPIPNGDYMIRVKVAFDKEYRTSIKIYAK 172
            ...:.:...|:|||.|.:|..|..|..:|..::::|:
  Fly   140 LNDDMISKAPVPNGFYKLRFIVKTDGVWRGEVEVHAE 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33700NP_001027121.3 DUF1091 71..153 CDD:284008 28/81 (35%)
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 28/77 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471977
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.840

Return to query results.
Submit another query.