DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33700 and CG33792

DIOPT Version :9

Sequence 1:NP_001027121.3 Gene:CG33700 / 3772390 FlyBaseID:FBgn0053700 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster


Alignment Length:207 Identity:53/207 - (25%)
Similarity:78/207 - (37%) Gaps:69/207 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARGLVI-----GICWTLLWSIFVAGD--FQLQNVICESFDNAITNFSRCEMKFIRRGVAAFYMV 58
            ||:.|.:     |:...|..:||.:..  |:::...|.:.....:|.| |.:|.:.         
  Fly     2 MAKWLAVSCVYLGVLLCLPNTIFYSNGYFFKIRKTECIANGAYFSNVS-CILKPVN--------- 56

  Fly    59 WKLYNVPIKSV-----DINVAL----------YK-KSNGYRPFLFNQTLDFCYYMRNPRAHPLIY 107
            |      .:||     ||..||          || .||.|:||......|.|..::|......:.
  Fly    57 W------TRSVLNMDGDIKEALTDIKMSVEVFYKDSSNLYKPFAVKFKFDVCQLLKNKTQSNFLQ 115

  Fly   108 ---MMHKVFMQASNINHSCPYDHDLIIN---------EFIYK-----------KNDLKDLPI-PN 148
               :.|  ..:.:|:||||||...|.|.         |:||.           :.|...||| |.
  Fly   116 KYAISH--LTEWTNVNHSCPYRVSLCIYNIVKFSQYIEYIYMFLKGHLIARNFRLDEVSLPILPI 178

  Fly   149 GDYMIRVKVAFD 160
            .||    |:||:
  Fly   179 QDY----KIAFN 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33700NP_001027121.3 DUF1091 71..153 CDD:284008 33/116 (28%)
CG33792NP_001027411.2 DUF1091 82..183 CDD:284008 30/106 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.