DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33700 and CG33688

DIOPT Version :9

Sequence 1:NP_001027121.3 Gene:CG33700 / 3772390 FlyBaseID:FBgn0053700 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster


Alignment Length:150 Identity:42/150 - (28%)
Similarity:78/150 - (52%) Gaps:7/150 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NVICESFDNAITNFSRCEMKFIRRGVAAFYMVWKLYNVPIKSVDINVALYKKSNGYRPFLFNQTL 91
            |:.|......|..|.:|.:|.:.|......:...|:...:.:|.: :.|.:.:|||:||..:.|:
  Fly    25 NLKCGIRGEKIYYFEKCFIKAVNRTHKYIDIYVNLHQQVVNNVTV-IKLMRHNNGYKPFFVDVTI 88

  Fly    92 DFCYYMRNPRAHPLIYMMHKVFMQASNINHSCPYDHDLIINEFIYKKN----DLKDLPIPNGDYM 152
            |.|.::::|| ..:|..::.::...|||||:||| .|::|...::..|    .:|.||:.:|||.
  Fly    89 DVCKFLKDPR-QSIIKKLYDIYKNNSNINHTCPY-KDVVIVHHLWTGNLESDFMKYLPLIDGDYA 151

  Fly   153 IRVKVAFDKEYRTSIKIYAK 172
            |..:.:.....|..|.:|.:
  Fly   152 IYTEWSVYNVARAFIDVYIR 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33700NP_001027121.3 DUF1091 71..153 CDD:284008 29/85 (34%)
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 29/81 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.